DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and decr1

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001002444.2 Gene:decr1 / 436717 ZFINID:ZDB-GENE-040718-142 Length:333 Species:Danio rerio


Alignment Length:264 Identity:69/264 - (26%)
Similarity:119/264 - (45%) Gaps:34/264 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLK---GTQAEIVVADVTK 63
            :..|||..:||..:|:|.|:...|:..||...:..|::..|:.|...:.   |.:...:..:|..
Zfish    54 TFKNKVAFITGGGTGLGKAMTTTLSSLGAECVIASRSLDVLQKTADEISQQTGNKVHAIRCNVRD 118

  Fly    64 DA--DAIVQQTLAKFGRIDVLVNNAGILGKGGLID----LDIEEFDAVLNTNLRGVILLTKAVLP 122
            .|  :|.|.|.:...|..||::|||.    |..|.    |....:..:....|.|...:|..:..
Zfish   119 PASVEAAVDQLVKDVGLPDVVINNAA----GNFISPSEKLSPNAWKTITEIVLNGNAYVTLDIGK 179

  Fly   123 HLLKT-KGA------VVNVSSCAG-IRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNP 179
            .|:|. |||      .:...|.:| :.|.|.|      |:.:::....:|.|.:..|:|.|.:.|
Zfish   180 RLIKAEKGAAFLSITTIYAESGSGFVVPSAAA------KSGVEKLCTSLAAEWSRYGMRFNVIQP 238

  Fly   180 GFVVTNIHRNIGIVDE-EYNGMLQRAI-NSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPID 242
            |.:.|.     |.... :..|:.::.| :...:||:|...|:|...|:|.|..||:.:||:..:|
Zfish   239 GPIKTK-----GAFSRLDPAGVFEKKILDRVAVGRLGTPGEIANLAAYLCSDYASWVSGAIIRMD 298

  Fly   243 GGKH 246
            ||::
Zfish   299 GGEY 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 67/260 (26%)
NADB_Rossmann 3..248 CDD:304358 69/263 (26%)
decr1NP_001002444.2 TER_DECR_SDR_a 55..301 CDD:187627 68/260 (26%)
PRK07677 57..302 CDD:181077 69/259 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.