DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and CG5590

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster


Alignment Length:201 Identity:62/201 - (30%)
Similarity:103/201 - (51%) Gaps:21/201 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGATLA-----------LVGRNVANLEATKKSLKGTQAEI 56
            |:.:.:.:||||.|||..||...||:||.:.           |.|...:..|..:|:  |.:|..
  Fly     7 LAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKA--GGKAYP 69

  Fly    57 VVADVTKDAD--AIVQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKA 119
            .|.||..:..  :.|:..:||||.||:::|||..:......|.|::.:|.:.|.|.||..|::|.
  Fly    70 CVVDVRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTPDTDMKRYDLMHNINTRGTFLVSKV 134

  Fly   120 VLPHLLKTKGA-VVNVSSCAGIRP--FAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGF 181
            .||:|.|:..| ::|:|....::|  |...::|.::|..:......:|.|...:|:.||::.|. 
  Fly   135 CLPYLKKSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGISVNALWPR- 198

  Fly   182 VVTNIH 187
              |.||
  Fly   199 --TAIH 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 62/201 (31%)
NADB_Rossmann 3..248 CDD:304358 62/201 (31%)
CG5590NP_651578.1 FabG 5..245 CDD:223959 62/201 (31%)
PRK08278 7..277 CDD:181349 62/201 (31%)
SCP2 317..406 CDD:280250
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435109
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.