DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and decr2

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_002932500.3 Gene:decr2 / 394884 XenbaseID:XB-GENE-5949565 Length:300 Species:Xenopus tropicalis


Alignment Length:265 Identity:85/265 - (32%)
Similarity:130/265 - (49%) Gaps:26/265 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLK---GTQAEIVVADVTKD 64
            |..:|..:||..||||..||::..|.|....:|.||:..:....:.||   |.:...:..|| :|
 Frog    32 LKGRVAFITGGGSGIGFRIAEIFMRHGCDTIIVSRNLQRVSEAAEKLKVSTGQRCLPLSGDV-RD 95

  Fly    65 A---DAIVQQTLAKFGRIDVLVNNAGILGKGGLI----DLDIEEFDAVLNTNLRGVILLTKAVLP 122
            |   :|.|::.|..|.|:|:|||||.    |..:    .|.:..|..|::.:..|....:|.:..
 Frog    96 AQSMNAAVEEALRIFSRVDILVNNAA----GNFLCPASSLSLNAFKTVIDIDTVGTFNASKILFE 156

  Fly   123 HLLKTKGAV-VNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVV-TN 185
            ...:..|.| ||:::....|.....:..|.:|||:|..|:.:|:|..|..||||.:.||.|. |.
 Frog   157 RFFRDNGGVIVNITATLSFRGQVLQVHAGSAKAAVDAMTRHLAVEWGPSRVRVNCLAPGPVSGTE 221

  Fly   186 IHRNIGIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGG-----K 245
            ..|.:|....|..|:..    :.|:.|:|:.||:|....||||..|||.||....:|||     :
 Frog   222 GMRRLGGAAAEAAGVWA----TLPLQRIGNKTEIAHGALFLASPLASFVTGTTLVMDGGSWMTSQ 282

  Fly   246 HNLTP 250
            ::|.|
 Frog   283 NHLAP 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 81/252 (32%)
NADB_Rossmann 3..248 CDD:304358 83/261 (32%)
decr2XP_002932500.3 TER_DECR_SDR_a 32..279 CDD:187627 83/255 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.