DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and dhrs4

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_956861.2 Gene:dhrs4 / 393539 ZFINID:ZDB-GENE-040426-1498 Length:276 Species:Danio rerio


Alignment Length:252 Identity:84/252 - (33%)
Similarity:135/252 - (53%) Gaps:10/252 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGTQAEIV--VADVTK- 63
            :||.||.|||.::.|||.|.|:.|.:.||.:.:..|...|::.....|:....:::  ..:|.| 
Zfish    27 NLSGKVAIVTASTDGIGLAAAEALGQRGAHVVVSSRRQTNVDKAVSLLRSKNIKVIGTTCNVGKA 91

  Fly    64 -DADAIVQQTLAKFGRIDVLVNNAGILG-KGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPHLLK 126
             |.:.::..|:.:.|.:|:||:||.:.. .|.::|...|.:|.:|..|::...||||.|:||:.|
Zfish    92 EDREKLINMTVEQCGGVDILVSNAAVNPFFGNILDSTEEVWDKILGVNVKASFLLTKMVVPHIEK 156

  Fly   127 T-KGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIHRNI 190
            . .|:||.|||.||.:|......|.|||.||...|:.:|.|:|...:|||.|.||.:.|.....:
Zfish   157 RGGGSVVIVSSVAGYQPMPALGPYSVSKTALLGLTRALAPELAQSNIRVNCVAPGIIKTRFSSAL 221

  Fly   191 GIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGGKHN 247
            .    |..|:|:..:....:.|:|...|:...:|||.|.:||:.||....:.||.::
Zfish   222 W----ENEGVLEEFLKQTSIKRLGQPEEIGGVIAFLCSDEASYITGETITVTGGMNS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 82/247 (33%)
NADB_Rossmann 3..248 CDD:304358 84/251 (33%)
dhrs4NP_956861.2 CR_SDR_c 21..276 CDD:187641 84/252 (33%)
fabG 28..272 CDD:235975 83/247 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.