DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and hsd20b2

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001373557.1 Gene:hsd20b2 / 368367 ZFINID:ZDB-GENE-030804-21 Length:329 Species:Danio rerio


Alignment Length:249 Identity:67/249 - (26%)
Similarity:107/249 - (42%) Gaps:59/249 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKG-------------TQAEIVVAD 60
            :||||:||||.|.|:.||:.|..:.|:.|:...|....|.::.             |:...:.:.
Zfish    58 VVTGATSGIGRAYAEELAKRGLNIVLISRSEEKLHRVAKEIEDKYNQKTHVIQADFTEGHSIYST 122

  Fly    61 VTKDADAIVQQTLAKFGRIDVLVNNAGILGKGGLID-LDIEEFD----AVLNTNLRGVILLTKAV 120
            :||..:.:         .|.:||||.|:...|.|.: ||:.:.|    .|||.|...|..:.:.:
Zfish   123 ITKQLEGL---------EIGILVNNVGMNYIGVLANFLDVPDPDQRITQVLNCNTLSVTQMCRVI 178

  Fly   121 LPHLL-KTKGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVT 184
            ||.:: :.||.::|:||.||.:|......|..:||.:..|:..:..|...:|:.|..|.|..|.|
Zfish   179 LPGMVERGKGLIINISSEAGYQPVPMVSLYSATKAFVTYFSLGLNAEYRSKGITVQCVAPFMVST 243

  Fly   185 NIHRNIGIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGAL 238
            |:..|:.:               :|                |..|.|||...||
Zfish   244 NMTHNVPV---------------NP----------------LVKSAASFARDAL 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 67/249 (27%)
NADB_Rossmann 3..248 CDD:304358 67/249 (27%)
hsd20b2NP_001373557.1 17beta-HSD1_like_SDR_c 54..296 CDD:187614 67/249 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.