DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and Hsd17b8

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_006256026.1 Gene:Hsd17b8 / 361802 RGDID:1303158 Length:273 Species:Rattus norvegicus


Alignment Length:263 Identity:86/263 - (32%)
Similarity:135/263 - (51%) Gaps:31/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSL----------KGTQAEIVVADVTKD 64
            ::||.||||.||:..||.|||.:|....:.|..:.|.:.|          :|..|.. .|||::.
  Rat    16 ISGAGSGIGRAISVRLAAEGAAVAACDLDGAAAQDTVRLLGNPGSEDREPRGKHAAF-QADVSEG 79

  Fly    65 --ADAIVQQTLAKFGR-IDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPHLLK 126
              |..:::|..|.|.| ..|:|:.|||.....|:.:..|::|.|:..||:|..|:|:|....|:.
  Rat    80 PAAKRLLEQVQACFFRPPSVVVSCAGITRDEFLLHMSEEDWDRVIAVNLKGTFLVTQAAAQALVS 144

  Fly   127 T--KGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIHRN 189
            :  :|:::|:||..|.....|..:|..|||.:...|:..|.|:...|:|.|||.|||:.|.:.:.
  Rat   145 SGGRGSIINISSIVGKVGNIGQTNYASSKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQK 209

  Fly   190 I-GIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPID-------GGKH 246
            : ..|.::...|:       |:|.:||..:||:.||||||..:.:.|||...:.       ||..
  Rat   210 MPEKVKDKVTAMI-------PLGHMGDPEDVADVVAFLASEDSGYITGASVEVSGMRPSWGGGPE 267

  Fly   247 NLT 249
            |.|
  Rat   268 NRT 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 82/256 (32%)
NADB_Rossmann 3..248 CDD:304358 84/260 (32%)
Hsd17b8XP_006256026.1 BKR_SDR_c 16..257 CDD:187594 82/248 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.