Sequence 1: | NP_569875.2 | Gene: | CG3699 / 31046 | FlyBaseID: | FBgn0040349 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001021972.1 | Gene: | dhs-6 / 3565470 | WormBaseID: | WBGene00000970 | Length: | 418 | Species: | Caenorhabditis elegans |
Alignment Length: | 195 | Identity: | 62/195 - (31%) |
---|---|---|---|
Similarity: | 97/195 - (49%) | Gaps: | 28/195 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 KVVIVTGASSGIGAAIAQVLAREGATLA-----------LVGRNVANLEATKKSLKGTQAEIVVA 59
Fly 60 DVTKDAD--AIVQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLP 122
Fly 123 HLLKTKGA-VVNVSS--CAGIRPFAGALS-----YGVSKAALDQFTKIVALEMAPQGVRVNSVNP 179
Fly 180 179 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3699 | NP_569875.2 | fabG | 1..244 | CDD:235546 | 62/195 (32%) |
NADB_Rossmann | 3..248 | CDD:304358 | 62/195 (32%) | ||
dhs-6 | NP_001021972.1 | PRK08278 | 9..275 | CDD:181349 | 62/195 (32%) |
SCP2 | 319..411 | CDD:376720 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0725 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |