DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and dhs-6

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001021972.1 Gene:dhs-6 / 3565470 WormBaseID:WBGene00000970 Length:418 Species:Caenorhabditis elegans


Alignment Length:195 Identity:62/195 - (31%)
Similarity:97/195 - (49%) Gaps:28/195 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVVIVTGASSGIGAAIAQVLAREGATLA-----------LVGRNVANLEATKKSLKGTQAEIVVA 59
            :.|::||||.|||..||..||::||.:.           |.|...:..|..:|:  |.:|...:.
 Worm    10 RTVLITGASRGIGKEIALKLAKDGANIVVAAKTATAHPKLPGTIYSAAEEIEKA--GGKALPCIV 72

  Fly    60 DVTKDAD--AIVQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLP 122
            ||..:|.  |.|::.:.|||.||:|:|||..:......:.:::.:|.:.:.|.||..|:||..||
 Worm    73 DVRDEASVKASVEEAVKKFGGIDILINNASAISLTDTENTEMKRYDLMHSINTRGTFLMTKTCLP 137

  Fly   123 HLLKTKGA-VVNVSS--CAGIRPFAGALS-----YGVSKAALDQFTKIVALEMAPQGVRVNSVNP 179
            :|...|.. |:|:|.  ....|.||..::     ||:|...|.|..     |..|.|:.||::.|
 Worm   138 YLKSGKNPHVLNISPPLLMETRWFANHVAYTMAKYGMSMCVLGQHE-----EFRPHGIAVNALWP 197

  Fly   180  179
             Worm   198  197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 62/195 (32%)
NADB_Rossmann 3..248 CDD:304358 62/195 (32%)
dhs-6NP_001021972.1 PRK08278 9..275 CDD:181349 62/195 (32%)
SCP2 319..411 CDD:376720
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.