DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and CG9150

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster


Alignment Length:244 Identity:73/244 - (29%)
Similarity:116/244 - (47%) Gaps:43/244 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NKVVIVTGASSGIGAAIAQVLAREGATLALVG--RNVANLEATKKSL-KGTQAEIVV--ADVTKD 64
            ||:.:|||||.|||||.|:.:.  ||.|.:||  |..|.|:..::|| :..||..:.  .||:|:
  Fly     6 NKLAVVTGASGGIGAACARAMI--GAGLRVVGLARREAKLKELRESLPRELQANFIPRRCDVSKE 68

  Fly    65 ADAIVQQTLAKFGRI-------DVLVNNAGILGKGGLI-DLDIEEFDAVLNTNLRGVILLTKAVL 121
                 .|..:.|..|       |||:|||||..:..|: ..:.::...|::||:.|||..|:...
  Fly    69 -----DQVQSSFDWIERELEGADVLLNNAGITRETELVTPSNTQKLKEVIDTNVMGVIWCTREAF 128

  Fly   122 PHLLKT--KGAVVNVSSCAG--IRPFAGALS----YGVSKAALDQFTKIVALE--MAPQGVRVNS 176
            .::.:.  :|.|:.::|.||  :..|...|.    |..:|.|:...|:....|  :....:||..
  Fly   129 NNMKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITETYRQEFQLHSNKIRVTG 193

  Fly   177 VNPGFVVTNIHRNIGIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAF 225
            :.||.|.||      |..||.:..::......|       ..:|:||.:
  Fly   194 ICPGAVNTN------IFPEEIHFYVKDMARLEP-------ANIADAVMY 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 73/244 (30%)
NADB_Rossmann 3..248 CDD:304358 73/244 (30%)
CG9150NP_608991.2 YdfG 1..251 CDD:226674 73/244 (30%)
NADB_Rossmann 1..247 CDD:304358 73/244 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435084
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.