DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and CG9360

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster


Alignment Length:240 Identity:79/240 - (32%)
Similarity:114/240 - (47%) Gaps:35/240 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGTQAEIV---VADVTK--- 63
            |:|.:|||||||||||..:.|..:|..:..:.|....|:..|.||...||...   ..||::   
  Fly     6 NRVAVVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKASLPADQASRFHGRKCDVSQEQE 70

  Fly    64 --DADAIVQQTLAKFGRIDVLVNNAGI--LGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPHL 124
              ||.|.:..||   |..|||||||||  ||.|...:.:..:..|:|:||:.||...|:.....|
  Fly    71 VIDAFAWIDATL---GGADVLVNNAGIVRLGVGITHEGNGADLRAILDTNVLGVSWCTREAFKSL 132

  Fly   125 LK---TKGAVVNVSSCAGIR----PFAGALSYGVSKAALDQFTKIVALEM--APQGVRVNSVNPG 180
            .:   ..|.::.|:|.||.|    |......|..||.|:...|:::..|.  .....::.|::||
  Fly   133 KRRNVNDGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNNKTQTKITSISPG 197

  Fly   181 FVVTNIHRNIGIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAF 225
            .|.|.      |:|:|    ....|...||.|..|   ||:|:::
  Fly   198 AVDTE------IIDKE----ALVGIPDFPMLRSED---VADAISY 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 79/240 (33%)
NADB_Rossmann 3..248 CDD:304358 79/240 (33%)
CG9360NP_572746.1 YdfG 1..250 CDD:226674 79/240 (33%)
NADB_Rossmann 1..246 CDD:304358 79/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435081
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.