DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and CG10962

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster


Alignment Length:244 Identity:77/244 - (31%)
Similarity:122/244 - (50%) Gaps:37/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGTQA---EIVVADVTKD-- 64
            |:|.:::|||||||||.|::|...|..:..:.|....||..::||...|.   .....||:::  
  Fly     6 NRVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSLPAEQRMRFHQHKCDVSQELQ 70

  Fly    65 ADAIVQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPHLLKTK- 128
            .|...:....:.|.||||:|||||:..|.|||:..::.:.:|.|||.|.|..||.....:.:.: 
  Fly    71 VDTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTKLAASSMRRRQV 135

  Fly   129 -GAVVNVSSCAGIR-----PFAGAL-SYGVSKAALDQFTKIVALEMAPQG--VRVNSVNPGFVVT 184
             |.::.|:|.||:.     |...:| :|..||.||....:|...|:..||  ::..|:|||:|.|
  Fly   136 AGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQGSKIKTTSINPGWVAT 200

  Fly   185 NIHRNIGIVDEEYNGMLQRAINSHPMGRVGDV----TEVAEAVAFLASS 229
            .|     :.||             ...::|:|    .:||:||.:..|:
  Fly   201 EI-----VPDE-------------TKAKLGEVILQADDVAQAVLYALST 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 77/244 (32%)
NADB_Rossmann 3..248 CDD:304358 77/244 (32%)
CG10962NP_788887.1 YdfG 1..249 CDD:226674 77/244 (32%)
NADB_Rossmann 1..243 CDD:304358 77/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435080
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.