DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and Hsdl2

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001020868.1 Gene:Hsdl2 / 313200 RGDID:1305387 Length:524 Species:Rattus norvegicus


Alignment Length:263 Identity:67/263 - (25%)
Similarity:114/263 - (43%) Gaps:48/263 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVAN---------LEATKKSLKGTQAEIVV 58
            |:...|.:||||.|||.|||...|::||.:.:..:....         ..|.:....|.:|...|
  Rat     8 LAGCTVFITGASRGIGKAIALKAAKDGANIVIAAKTTQRHPKLLGTIYTAAEEIEAAGGKALPCV 72

  Fly    59 ADV--TKDADAIVQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVL 121
            .||  .:..::.|::.:.:||.||:|||||..:.....::...:..|.:::.|.||..|.:||.:
  Rat    73 VDVRDEQQINSAVEKAVERFGGIDILVNNASAISLTNTLETPTKRVDLMMSVNTRGTYLTSKACI 137

  Fly   122 PHLLKTKGA-VVNVSSCAGIRP--FAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVV 183
            |.|.|:|.| ::|:|....:.|  |....:|.::|..:......:|.|...: :.||::.|    
  Rat   138 PFLKKSKVAHILNLSPPLNLNPMWFKQHCAYTIAKYGMSMCVLGMAEEFRGE-IAVNALWP---- 197

  Fly   184 TNIHRNIGIVDEEYNGMLQRAINSHPMGRVG---------DVTEVAEAVAFLASSKASFTTGALF 239
                              :.||::..|..:|         .|..:|:|...:.....|||..  |
  Rat   198 ------------------RTAIHTAAMDMLGGAGVESQCRKVDIIADAAYSIFKRPKSFTGN--F 242

  Fly   240 PID 242
            .||
  Rat   243 IID 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 67/263 (25%)
NADB_Rossmann 3..248 CDD:304358 67/263 (25%)
Hsdl2NP_001020868.1 HSDL2_SDR_c 8..248 CDD:187663 67/263 (25%)
adh_short 12..197 CDD:278532 52/185 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..410
SCP2 424..517 CDD:280250
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.