DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and Cbr3

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001100580.1 Gene:Cbr3 / 304078 RGDID:1309728 Length:277 Species:Rattus norvegicus


Alignment Length:247 Identity:68/247 - (27%)
Similarity:103/247 - (41%) Gaps:63/247 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLSNKVVIVTGASSGIGAAIAQVLARE-GATLALVGRNVANLEATKKSLKGT-------QAEIV 57
            ||..::|.:||||:.|||.||.:.|.|: ...:.|..|:.|...|..|.|:..       |.:| 
  Rat     1 MSSCSRVALVTGANKGIGFAITRDLCRKFSGDVVLTARDEARGRAAVKQLQAEGLSPRFHQLDI- 64

  Fly    58 VADVTKDADAIVQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLP 122
              |..:...|:......::|.::||||||||..:   :| |...||......|:.....|:.|..
  Rat    65 --DNPQSIRALRDFLRKEYGGLNVLVNNAGIAFR---MD-DPTPFDVQAEVTLKTNFFATRNVCT 123

  Fly   123 HLL---KTKGAVVNVSSCAGIRPF-----------------AGAL-------------------- 147
            .||   |..|.||||||..|::..                 .|.|                    
  Rat   124 ELLPIMKPHGRVVNVSSLQGLKALENCSEDLQERFRCDTLTEGDLVDLMKKFVEDTKNEVHEREG 188

  Fly   148 ----SYGVSKAALDQFTKIVALEM----APQGVRVNSVNPGFVVTNIHRNIG 191
                :|||||..:...|:|:|.::    ....:.:|:..||:|.|::.|:.|
  Rat   189 WPDSAYGVSKLGVTVLTRILARQLDEKRKADRILLNACCPGWVKTDMARDQG 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 68/247 (28%)
NADB_Rossmann 3..248 CDD:304358 66/245 (27%)
Cbr3NP_001100580.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 66/242 (27%)
adh_short 6..241 CDD:278532 66/242 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334271
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.