DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and Bdh2

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001099943.1 Gene:Bdh2 / 295458 RGDID:1309898 Length:255 Species:Rattus norvegicus


Alignment Length:245 Identity:86/245 - (35%)
Similarity:130/245 - (53%) Gaps:9/245 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGTQAEIVVADVTKDADA 67
            |..||:::|.|:.|||.|.|...|||||.:.....|.|.|:.. ::..|.|..::  ||||... 
  Rat    14 LEGKVIVLTAAAQGIGRASALAFAREGAKVIATDINEAKLQEL-ENYPGIQTRVL--DVTKKRQ- 74

  Fly    68 IVQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPHLLKTK-GAV 131
             :.|..::..:||||.|.||.:..|.::|.:.:::|..:|.|:|.:.|:.||.||.:|..| |.:
  Rat    75 -IDQFASEIEKIDVLFNVAGFVHHGTILDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNI 138

  Fly   132 VNVSSCA-GIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVT-NIHRNIGIVD 194
            :|:||.| .|:.......|..:|||:...||.||.:...||:|.|.|.||.|.| ::...|...|
  Rat   139 INMSSVASSIKGVENRCVYSATKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARD 203

  Fly   195 EEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGG 244
            :.... |:..:|....||.....|||....:|||.::::.||....||||
  Rat   204 DPKEA-LKAFLNRQKTGRFASAEEVALLCVYLASDESAYVTGTPVVIDGG 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 84/243 (35%)
NADB_Rossmann 3..248 CDD:304358 86/245 (35%)
Bdh2NP_001099943.1 PRK06138 12..254 CDD:235712 86/245 (35%)
DHRS6_like_SDR_c 15..255 CDD:187626 85/244 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.