DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and Dhrs4

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001033027.2 Gene:Dhrs4 / 28200 MGIID:90169 Length:279 Species:Mus musculus


Alignment Length:256 Identity:89/256 - (34%)
Similarity:135/256 - (52%) Gaps:18/256 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGTQAEI--VVADVTK-- 63
            |||||.:||.::.|||.|||:.||.:||.:.:..|...|::....:|:|....:  :|..|.|  
Mouse    31 LSNKVALVTASTDGIGFAIARRLAEDGAHVVVSSRKQQNVDRAVATLQGEGLSVTGIVCHVGKAE 95

  Fly    64 DADAIVQQTLAKFGRIDVLVNNAGILG-KGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPHLLKT 127
            |.:.::...|.:...||:||:||.:.. .|.|:|:..|.:|.||:.|:....::.|||:|.:.|.
Mouse    96 DREKLITTALKRHQGIDILVSNAAVNPFFGNLMDVTEEVWDKVLSINVTATAMMIKAVVPEMEKR 160

  Fly   128 -KGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIHRNIG 191
             .|:||.|.|.||...|.....|.|||.||...||..|.|:||:.:|||.:.||.:.|   |...
Mouse   161 GGGSVVIVGSVAGFTRFPSLGPYNVSKTALLGLTKNFAAELAPKNIRVNCLAPGLIKT---RFSS 222

  Fly   192 IVDEE--YNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGGKHNLTP 250
            ::.||  ....::.|:.   :.|:|...:.|..|:||.|..||:..|....:.||    ||
Mouse   223 VLWEEKAREDFIKEAMQ---IRRLGKPEDCAGIVSFLCSEDASYINGETVVVGGG----TP 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 85/248 (34%)
NADB_Rossmann 3..248 CDD:304358 87/252 (35%)
Dhrs4NP_001033027.2 CR_SDR_c 24..279 CDD:187641 89/256 (35%)
fabG 31..274 CDD:235975 85/248 (34%)
Microbody targeting signal 277..279 89/256 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830562
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.