DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and Decr2

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_036063.1 Gene:Decr2 / 26378 MGIID:1347059 Length:292 Species:Mus musculus


Alignment Length:254 Identity:77/254 - (30%)
Similarity:126/254 - (49%) Gaps:21/254 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSL---KGTQAEIVVADVTKD 64
            |.:||..:||..||||..||::..|.|....:|||::..:....|.|   .|.:...:..||...
Mouse    26 LQDKVAFITGGGSGIGFRIAEIFMRHGCHTVIVGRSLQKVTTAAKKLVAATGKRCLPLSMDVRVP 90

  Fly    65 ADAI--VQQTLAKFGRIDVLVNNAGILGKGGLI----DLDIEEFDAVLNTNLRGVILLTKAVLPH 123
            .:.:  |.|.|.:||:|::|:|.|.    |..:    .|....|..|::.:..|...::..:...
Mouse    91 PEVMTAVDQALQEFGKINILINCAA----GNFLCPASALSFNAFKTVVDIDTIGTFNVSSVLYKK 151

  Fly   124 LLKTKGAV-VNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFV--VTN 185
            ..:..|.| ||:::...:|.....|..|.:|||:|..|:.:|:|..||.:||||:.||.:  ...
Mouse   152 FFRDHGGVIVNITATLSMRGQVLQLHAGAAKAAVDAMTRHLAVEWGPQNIRVNSLAPGAISGTEG 216

  Fly   186 IHRNIGIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGG 244
            :.|..|     .|...:....|:|:.|:|..||:|.:|.:|||..||:.:|.:..:|||
Mouse   217 LRRLRG-----SNASSKLKHFSNPIPRLGTKTEIAHSVLYLASPLASYVSGIVLVVDGG 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 75/252 (30%)
NADB_Rossmann 3..248 CDD:304358 77/254 (30%)
Decr2NP_036063.1 TER_DECR_SDR_a 26..273 CDD:187627 77/254 (30%)
PRK07576 26..271 CDD:236056 77/254 (30%)
Substrate binding. /evidence=ECO:0000250 126..128 0/1 (0%)
Microbody targeting signal. /evidence=ECO:0000250 290..292
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.876977 Normalized mean entropy S1395
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.