DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and SPAC922.06

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_595006.1 Gene:SPAC922.06 / 2543550 PomBaseID:SPAC922.06 Length:258 Species:Schizosaccharomyces pombe


Alignment Length:256 Identity:84/256 - (32%)
Similarity:130/256 - (50%) Gaps:31/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGTQAEIVVADVTKDA 65
            |::..:||::|||:.|||..:.::...       :|..||.::....|.....|..:.|||:| |
pombe     1 MTVEGRVVLITGAAGGIGKVLCKMFTE-------LGDRVAGIDIVDPSKVQDAALALQADVSK-A 57

  Fly    66 DAI---VQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPHLLK- 126
            |.|   :::.:...|.||||:||||:........|..|.:|..::..|||..|..:.|:||:.| 
pombe    58 DQIETAIEKVIQTLGPIDVLINNAGLADDTPFEQLSHESWDHDVSLVLRGNYLTQRYVIPHMAKQ 122

  Fly   127 -TKGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVT------ 184
             ..|::||:.|..| ..:.|:.:|..:||.|:..||.:|:...|.|:|||...||.:.:      
pombe   123 GKGGSIVNIGSVNG-HIYLGSPAYSAAKAGLENLTKALAVRYGPLGIRVNVCAPGTIWSPAWDER 186

  Fly   185 -NIHRNIGIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGG 244
             ..|.::|          .|....:|:||:|...:||.||.|||.||.||.||....:|||
pombe   187 FKKHPDVG----------DRMKRWYPVGRLGTPEDVARAVIFLADSKNSFITGTTLYVDGG 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 82/254 (32%)
NADB_Rossmann 3..248 CDD:304358 83/254 (33%)
SPAC922.06NP_595006.1 PRK07074 6..248 CDD:180823 83/251 (33%)
SDR_c 8..235 CDD:212491 79/245 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm47173
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.