DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and SPBC30D10.05c

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_596280.1 Gene:SPBC30D10.05c / 2540402 PomBaseID:SPBC30D10.05c Length:247 Species:Schizosaccharomyces pombe


Alignment Length:251 Identity:73/251 - (29%)
Similarity:119/251 - (47%) Gaps:35/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGTQAEI-VVADVTKDADA 67
            :.||:::||:|.|||.|.|:.|.::...:|:.......||..  .::...:.: |..|||:...|
pombe     5 AEKVILLTGSSKGIGLATAEALQKKAKVIAVSRSLTPELETL--LIQNPDSFVHVKGDVTEVGKA 67

  Fly    68 IVQQTLAKFGRIDVLVNNAGILGK-GGLIDLDIEEFDAVLNTNLRGVILLTKAVLPHLLKTKGAV 131
            .::..:.|||::|.::.|||:|.. ..:.|.||.|:..:.:.|...|:...|..:|||.||||.:
pombe    68 SIETAIKKFGKLDSVILNAGVLEPIAKIADADINEWRKLFDINFFSVVETVKYAIPHLRKTKGTI 132

  Fly   132 VNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIHRNIGIVDEE 196
            |.|||.|.:|.|....:|..||||::.....:..| .|..:.| :|.|           |:||..
pombe   133 VIVSSGAAVRVFPAWAAYCCSKAAINMLVMNLGSE-EPDIMSV-AVRP-----------GVVDTP 184

  Fly   197 YNGMLQRAINSHPMGRVGDV----------------TEVAEAVAFLASSKASFTTG 236
            ....::...|...||  ||.                .::|:|::|||.:.....||
pombe   185 MQVSIRNDSNKEAMG--GDTHNFFKELKTSGQLVAPQDIAKALSFLALNNNPKLTG 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 73/251 (29%)
NADB_Rossmann 3..248 CDD:304358 73/251 (29%)
SPBC30D10.05cNP_596280.1 adh_short 7..190 CDD:278532 61/197 (31%)
SPR-like_SDR_c 8..245 CDD:187625 72/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.