DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and SPCC1739.08c

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_588416.1 Gene:SPCC1739.08c / 2539211 PomBaseID:SPCC1739.08c Length:261 Species:Schizosaccharomyces pombe


Alignment Length:258 Identity:73/258 - (28%)
Similarity:116/258 - (44%) Gaps:33/258 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLK--GTQAEIVVADVTKD 64
            ||..|..:|.||:.|||.:||...|:.|..:.:........|..||..:  |.|...:..|:::.
pombe    18 SLKGKNCVVFGAAKGIGFSIATAFAQAGGNVIITYLTTDPTEKAKKLAEETGVQVHTLKIDISRS 82

  Fly    65 --ADAIVQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVI--------LLTKA 119
              .:|.|::....|..|.|:|.|||:..:..::|....||:.|:|.|...|.        :..|.
pombe    83 DTVEAGVEEIQKIFKEIHVVVANAGMPFRRSVLDSPPHEFEKVMNINTNSVYRVAYYMGKIFKKQ 147

  Fly   120 VLPHLLKT---KGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGF 181
            ...:|:.|   ...:||...        ...:|..||||:.|..|.:|:|.| :..|:|||:||:
pombe   148 GFGNLIATASMSATIVNAPQ--------HIAAYCASKAAVRQLCKALAVEWA-EFARINSVSPGY 203

  Fly   182 VVTNIHRNIGIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGG 244
            ..|::        ..|. .|::.....|..|:|...|:.....:|||:.:||.||....:|||
pombe   204 FATDM--------PGYE-FLKQWEPYVPFKRLGLTPELRGTYLYLASNASSFVTGLDLIVDGG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 71/256 (28%)
NADB_Rossmann 3..248 CDD:304358 72/257 (28%)
SPCC1739.08cNP_588416.1 PRK05867 13..260 CDD:135631 73/258 (28%)
MDH-like_SDR_c 14..260 CDD:187610 73/258 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.