DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and ZK829.1

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_502263.1 Gene:ZK829.1 / 191434 WormBaseID:WBGene00014093 Length:284 Species:Caenorhabditis elegans


Alignment Length:261 Identity:100/261 - (38%)
Similarity:147/261 - (56%) Gaps:22/261 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGTQAE-----IVVADVTK 63
            |.|||:::|:|.|||.|.|...|.|||.:.|.||:..::|.|:|......|:     ..|.|:|.
 Worm     7 SGKVVLISGSSKGIGQATAVKFAAEGAKIVLNGRSADDVEKTRKLCMEVGAKPWDLLPTVGDITN 71

  Fly    64 D--ADAIVQQTLAKFGRIDVLVNNAGIL-----GKGGLIDLDIEEFDAVLNTNLRGVILLTKAVL 121
            :  ...:|...:..||::|:|:||||.|     ||.|. ::.::..|...|:|.:.|::||:|.:
 Worm    72 EDFVKMMVNTVIHNFGKLDILINNAGTLEVDMTGKEGW-EMGVDVMDRSWNSNFKSVLMLTQAAM 135

  Fly   122 PHLLKTKGAVVNVSSCAGIRPFAGALS---YGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVV 183
            |||:||||.:||||:.....|. |.:|   |.|.||||||.::.:|.|...:|||:|:||||.|.
 Worm   136 PHLIKTKGDIVNVSTFLSSGPI-GVMSMPYYAVPKAALDQMSRSMAHEYMLKGVRLNTVNPGLVS 199

  Fly   184 TNIHRNI-GIVDEEYNGM---LQRAINSHPMGRVGDVTEVAEAVAFLASSKAS-FTTGALFPIDG 243
            |:....: |:.|:....|   :|......|:|||...::|||.:.|||..|.| ...|....|||
 Worm   200 TSFFARLPGVGDDNARKMENYVQSKTEYIPLGRVCQASDVAETILFLADRKVSECIVGQSIIIDG 264

  Fly   244 G 244
            |
 Worm   265 G 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 98/259 (38%)
NADB_Rossmann 3..248 CDD:304358 100/261 (38%)
ZK829.1NP_502263.1 FabG 5..265 CDD:223959 98/259 (38%)
NADB_Rossmann 6..268 CDD:304358 100/261 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45843
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100756
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.690

Return to query results.
Submit another query.