DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and W03F9.9

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_503143.1 Gene:W03F9.9 / 189164 WormBaseID:WBGene00021003 Length:280 Species:Caenorhabditis elegans


Alignment Length:263 Identity:95/263 - (36%)
Similarity:140/263 - (53%) Gaps:27/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSL-----KGTQAEIVVADVTK 63
            :::|.||||:|:|||.|.|.:||.|||.:.:.|||...||.::::|     .......||||||.
 Worm     6 TDEVAIVTGSSNGIGRATAILLASEGAKVTITGRNAERLEESRQALLKVGVPSGHINSVVADVTT 70

  Fly    64 DA--DAIVQQTLAKFGRIDVLVNNAGILGKGGLIDLD--------IEEFDAVLNTNLRGVILLTK 118
            .|  |.::..||.|||:|::|:||||.|    ::|.:        :|........|.:.|:.:|:
 Worm    71 GAGQDVLIDSTLKKFGKINILINNAGAL----IVDPEGKTNTSTGVETCLKTFQLNFQSVVEMTQ 131

  Fly   119 AVLPHLLKTKGAVVNVSSCAGIRPFAGAL--SYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGF 181
            .:.|||..|.|.:||||| .|..|.|...  .|..:||||||:::..|:::.|.|:|||.|.|||
 Worm   132 KIRPHLANTHGEIVNVSS-VGAGPAAENRFPYYSAAKAALDQYSRNTAIDLIPDGIRVNIVQPGF 195

  Fly   182 VVTNIHRNIGIVDEEYNGMLQRAINSH----PMGRVGDVTEVAEAVAFLASSKAS-FTTGALFPI 241
            |.|........:..:.:..:...|.::    |.|..|....:|..:||||..||| :..|.....
 Worm   196 VATGFTTAASGMSPDASAKMYEGIGANTSCIPAGYCGRPEHLASVIAFLADRKASEYIVGQTIIA 260

  Fly   242 DGG 244
            |||
 Worm   261 DGG 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 93/261 (36%)
NADB_Rossmann 3..248 CDD:304358 95/263 (36%)
W03F9.9NP_503143.1 FabG 4..263 CDD:223959 93/261 (36%)
NADB_Rossmann 5..267 CDD:304358 95/263 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45843
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100756
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.680

Return to query results.
Submit another query.