DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and R05D8.7

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_503751.1 Gene:R05D8.7 / 187608 WormBaseID:WBGene00019885 Length:280 Species:Caenorhabditis elegans


Alignment Length:263 Identity:109/263 - (41%)
Similarity:145/263 - (55%) Gaps:28/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEAT-----KKSLKGTQAEIVVADVTK 63
            |||.||:||:|:|||...|.:.|:|||.:.:.||:...||.|     |..:...|...||||||.
 Worm     5 SNKTVIITGSSNGIGRTTAILFAQEGANVTITGRSSERLEETRQIILKSGVSEKQVNSVVADVTT 69

  Fly    64 D--ADAIVQQTLAKFGRIDVLVNNAG-----ILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVL 121
            :  .|.|:..||.:||:|||||||||     ..|..| .|..|:.:...|..||:.||.:||.|.
 Worm    70 EDGQDQIINSTLKQFGKIDVLVNNAGAAIPDAFGTTG-TDQGIDIYHKTLKLNLQAVIEMTKKVK 133

  Fly   122 PHLLKTKGAVVNVSS-CAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTN 185
            |||:.:||.:||||| .||.:.....|.|.::||||||:|:..|:::|..|:|||||:||.|.|.
 Worm   134 PHLVASKGEIVNVSSIVAGPQAQPDFLYYAIAKAALDQYTRSTAIDLAKFGIRVNSVSPGMVETG 198

  Fly   186 IHRNIGIVDEE----YNGMLQRAINSH----PMGRVGDVTEVAEAVAFLASSKASF-TTGALFPI 241
            ....:|:.|:.    ||.|.     ||    |:|..|....:|..:.|||....|| ..|.....
 Worm   199 FTNAMGMPDQASQKFYNFMA-----SHKECIPIGAAGKPEHIANIILFLADRNLSFYILGQSIVA 258

  Fly   242 DGG 244
            |||
 Worm   259 DGG 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 107/261 (41%)
NADB_Rossmann 3..248 CDD:304358 109/263 (41%)
R05D8.7NP_503751.1 FabG 3..261 CDD:223959 107/261 (41%)
SDR_c11 4..265 CDD:187622 109/263 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45843
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100756
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.690

Return to query results.
Submit another query.