DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and F59E11.2

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_505327.2 Gene:F59E11.2 / 186621 WormBaseID:WBGene00019109 Length:321 Species:Caenorhabditis elegans


Alignment Length:298 Identity:84/298 - (28%)
Similarity:124/298 - (41%) Gaps:69/298 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRN----------------VANLEATKKSLKG 51
            |.::|.:|||||.|||..||..|...|||:.:.||.                ||. |.|.:..||
 Worm     5 LQDQVALVTGASRGIGRGIALQLGEAGATVYITGRRPELSDNFRLGLPSLDYVAK-EITSRGGKG 68

  Fly    52 ----------TQAEIVVADVTKDADAIVQQTLAKFGRIDVLVNNA-GILGKG------GLIDLDI 99
                      |:.:.:...:.:|.:          |::|:||||. ..|||.      ...|.|.
 Worm    69 IALYVDHSNMTEVKFLFEKIKEDEE----------GKLDILVNNVYNSLGKATEMIGKTFFDQDP 123

  Fly   100 EEFDAVLNTNLRG-VILLTKAVLPHLLKTKGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIV 163
            ..:|.:....||. ......|....:.:.||.:|||.|..|:: :...::||..|.||.:.:..:
 Worm   124 SFWDDINGVGLRNHYYCSVYAARMMVERRKGLIVNVGSLGGLK-YVFNVAYGAGKEALARMSTDM 187

  Fly   164 ALEMAPQGVRVNSVNPGFVVTNIHRNIGIVDEEY-----NGMLQRAINSHPMGRVGDVTE-VAEA 222
            |:|:.|..|.|.::.||.|.|.. .|..|:|:.|     |..|:..|.       |:.|| ..:|
 Worm   188 AVELNPYNVCVVTLIPGPVKTET-ANRTIIDDAYKMIKENPELEEFIK-------GESTEYTGKA 244

  Fly   223 VAFLA--------SSKASFTTGALFPID-GGKHNLTPR 251
            :|.||        |.|..||.......| ..||.:.|:
 Worm   245 LARLAMDPGKLKKSGKTLFTEDLAQKYDFSDKHGMEPQ 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 81/289 (28%)
NADB_Rossmann 3..248 CDD:304358 83/293 (28%)
F59E11.2NP_505327.2 PRK08303 5..281 CDD:236229 83/295 (28%)
NADB_Rossmann 5..278 CDD:304358 82/292 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.