DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and F28H7.2

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_505742.1 Gene:F28H7.2 / 185096 WormBaseID:WBGene00009236 Length:284 Species:Caenorhabditis elegans


Alignment Length:263 Identity:102/263 - (38%)
Similarity:153/263 - (58%) Gaps:27/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGT-----QAEIVVADVTK 63
            ::||.|:||:|:|||.|.|::||.|||.:.:.|||...||.||..|.|.     ...:||.|:|:
 Worm     5 TDKVAIITGSSNGIGQATARLLASEGAKVTVTGRNAERLEETKNILLGAGVPEGNVLVVVGDITQ 69

  Fly    64 DA--DAIVQQTLAKFGRIDVLVNNAG-----ILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVL 121
            ::  :.:::.||.|||:||:||||||     ..||.| ::..|:.:......|::.||.:|:...
 Worm    70 ESVQENLIKSTLDKFGKIDILVNNAGAGIPDAQGKSG-VNQSIDTYHKTFELNVQSVIEMTQKAR 133

  Fly   122 PHLLKTKGAVVNVSSCAGIRPFAGALS--YGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVT 184
            |||.||:|.:||:|| .|..|.|...|  |.::||||||:|:..|:::.|:|:|||||:||.|.|
 Worm   134 PHLAKTQGEIVNISS-IGAGPAAQVASPYYSIAKAALDQYTRTAAIDLVPEGIRVNSVSPGAVST 197

  Fly   185 NIHR-NIGIVDE------EYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKAS-FTTGALFPI 241
            .... :.|:.:|      :|.|..:..|   |.|......::|:.:||||...|| :..|.....
 Worm   198 GFSAVSRGLTEEKSKAFYDYLGAQRECI---PRGFCAVPEDIAKVIAFLADRNASNYIIGQTIVA 259

  Fly   242 DGG 244
            |||
 Worm   260 DGG 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 100/261 (38%)
NADB_Rossmann 3..248 CDD:304358 102/263 (39%)
F28H7.2NP_505742.1 fabG 3..262 CDD:235506 100/261 (38%)
NADB_Rossmann 4..266 CDD:304358 102/263 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45843
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100756
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.690

Return to query results.
Submit another query.