DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and stdh-2

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_507092.1 Gene:stdh-2 / 184337 WormBaseID:WBGene00008678 Length:315 Species:Caenorhabditis elegans


Alignment Length:237 Identity:63/237 - (26%)
Similarity:107/237 - (45%) Gaps:34/237 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGTQAEIVVA----DVTKDADAIV 69
            :||||:.|||.:.:..|||.|..:.:|.|..:.||.|||.:...|.:|.|.    |.|..:....
 Worm    51 VVTGATDGIGKSYSFELARRGFNVYIVSRTQSKLEQTKKDILEKQPDIEVRFATYDFTNPSVTDY 115

  Fly    70 QQTLAKFGRIDV--LVNNAG-------ILGK--GGLIDLDIEEFDAVLNT---NLRGVILLTKAV 120
            ::.|:|...:.|  |:||.|       :|.|  ||:        |::.|.   |.....||:..:
 Worm   116 EKLLSKLNEVSVGILINNVGMFFDYPEMLHKINGGI--------DSIANVIIINTLPATLLSAGI 172

  Fly   121 LPHLLKTK-GAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVT 184
            ||.::..| |.:||:.|.||:...|....|..:|..::..|..:..|.:..|:...::.|..|.|
 Worm   173 LPQMVSRKAGIIVNIGSFAGVVKLAEWSIYSATKKYVEWLTGCLRKEYSHHGIIFQAITPAMVAT 237

  Fly   185 NI--HRNIGIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVA 224
            .:  :.|......:.:...:.|:|:     :|..:|....:|
 Worm   238 KMAGNPNTSFFCPDSDTFARSALNT-----IGHASETTGYIA 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 63/237 (27%)
NADB_Rossmann 3..248 CDD:304358 63/237 (27%)
stdh-2NP_507092.1 PLN02780 19..312 CDD:166421 63/237 (27%)
17beta-HSD1_like_SDR_c 47..289 CDD:187614 63/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.