DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and F02C12.2

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_510229.1 Gene:F02C12.2 / 184076 WormBaseID:WBGene00008516 Length:278 Species:Caenorhabditis elegans


Alignment Length:264 Identity:104/264 - (39%)
Similarity:149/264 - (56%) Gaps:29/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSL-----KGTQAEIVVADVT- 62
            |.||.|:||:|||||...|.:.|:|||.:.:.||:...||.|||:|     |.:...||.||:| 
 Worm     6 SKKVAIITGSSSGIGRETALLFAKEGAKVTVTGRSEEKLEETKKALLDAGIKESNFLIVPADITF 70

  Fly    63 -KDADAIVQQTLAKFGRIDVLVNNAGI----LGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLP 122
             ...|.::.|||.|||||::||||||.    ..|...||..||.::.|:..|::.||.:|:.|.|
 Worm    71 STGQDELISQTLKKFGRINILVNNAGASIPDAKKRTGIDQGIETYEQVMKLNVQSVIEMTQKVRP 135

  Fly   123 HLLKTKGAVVNVSSCAGIR------PFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGF 181
            ||.|::|.:|||||...::      |:     |.::||||||:|:..|:.:..:|:|||:||||.
 Worm   136 HLAKSRGEIVNVSSVVALKAGWTRTPY-----YPLAKAALDQYTRSAAIALISEGIRVNTVNPGI 195

  Fly   182 VVTNIHRNI-GIVDEE----YNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKAS-FTTGALFP 240
            |.|....|. |...::    |:.|.... .:.|.|..|....:|:|:||||...:| :..|....
 Worm   196 VQTGFQANASGSSSDDAQKFYDDMGSNT-TAIPCGFAGRPEHIAKAIAFLADRNSSEYIVGQNII 259

  Fly   241 IDGG 244
            .|||
 Worm   260 ADGG 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 102/262 (39%)
NADB_Rossmann 3..248 CDD:304358 104/264 (39%)
F02C12.2NP_510229.1 FabG 4..263 CDD:223959 102/262 (39%)
NADB_Rossmann 5..267 CDD:304358 104/264 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45843
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100756
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.680

Return to query results.
Submit another query.