DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and D1054.8

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_505755.1 Gene:D1054.8 / 183917 WormBaseID:WBGene00008375 Length:278 Species:Caenorhabditis elegans


Alignment Length:261 Identity:107/261 - (40%)
Similarity:152/261 - (58%) Gaps:24/261 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGT-----QAEIVVADVTK 63
            :.||.|:||:|:|||.|.|.:.|||||.:.:.||:...||.|::.:...     ....||||||.
 Worm     5 AEKVAIITGSSNGIGRATAVLFAREGAKVTITGRHAERLEETRQQILAAGVSEQNVNSVVADVTT 69

  Fly    64 DA--DAIVQQTLAKFGRIDVLVNNAGIL-----GKGGLIDLDIEEFDAVLNTNLRGVILLTKAVL 121
            ||  |.|:..||.|||::|:||||||..     .|.|... .||.:||.||.|||.||.|||..:
 Worm    70 DAGQDEILSTTLGKFGKLDILVNNAGAAIPDSQSKTGTAQ-SIESYDATLNLNLRSVIALTKKAV 133

  Fly   122 PHLLKTKGAVVNVSSCA-GIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTN 185
            |||..|||.:||:||.| |:........|.::|||:||:|:..|:::...|:||||::||.|.|.
 Worm   134 PHLSSTKGEIVNISSIASGLHATPDFPYYSIAKAAIDQYTRNTAIDLIQHGIRVNSISPGLVATG 198

  Fly   186 IHRNIGIVDEE----YNGM--LQRAINSHPMGRVGDVTEVAEAVAFLASSK-ASFTTGALFPIDG 243
            ....:|:.:|.    |:.|  ::..:   |.|.:|...::||.:||||..| :|:..|....:||
 Worm   199 FGSAMGMPEETSKKFYSTMATMKECV---PAGVMGQPQDIAEVIAFLADRKTSSYIIGHQLVVDG 260

  Fly   244 G 244
            |
 Worm   261 G 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 105/259 (41%)
NADB_Rossmann 3..248 CDD:304358 107/261 (41%)
D1054.8NP_505755.1 FabG 3..261 CDD:223959 105/259 (41%)
SDR_c11 4..265 CDD:187622 107/261 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45843
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100756
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.720

Return to query results.
Submit another query.