DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and C06E4.6

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_501154.1 Gene:C06E4.6 / 182329 WormBaseID:WBGene00015535 Length:274 Species:Caenorhabditis elegans


Alignment Length:267 Identity:98/267 - (36%)
Similarity:140/267 - (52%) Gaps:35/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEAT-----KKSLKGTQAEIVVADVT- 62
            ::||.|:||:|:|||.|.|.:||.:||.:.:.||:.|.||.|     |..:..|....|||||| 
 Worm     5 TDKVAIITGSSNGIGRATAVLLATDGAKVTITGRDAARLEETRQAILKAGISATNVNSVVADVTT 69

  Fly    63 -KDADAIVQQTLAKFGRIDVLVNNAGILGKGGLID--------LDIEEFDAVLNTNLRGVILLTK 118
             :..|.::..||.|||:|::|:||||    ..:.|        ..||....:...||:.|:.:.:
 Worm    70 AEGQDLLISSTLDKFGKINILINNAG----ANIPDSQGQTRTKCSIENLTKMFQLNLQSVVEMVQ 130

  Fly   119 AVLPHLLKTKGAVVNVSSCAGIRPFAGALS--YGVSKAALDQFTKIVALEMAPQGVRVNSVNPGF 181
            .|.|||.||:|.:||:|| .|..|.|...|  |..:||||||:::..|:::..:|:|:|.|.|||
 Worm   131 KVRPHLAKTRGEIVNISS-IGAGPAAQPASPYYSSAKAALDQYSRCAAIDLISEGIRINVVQPGF 194

  Fly   182 VVTNIH---RNIGIVDE-----EYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKAS-FTTGA 237
            |.|...   |.:. .||     :..|.|...|   |.|..|....:|..:|||...|.| :..|.
 Worm   195 VSTGFSTAARGLS-ADESVKFYDLMGSLPHCI---PAGYCGQPDHLASVIAFLVDRKVSEYIVGQ 255

  Fly   238 LFPIDGG 244
            ....|||
 Worm   256 TIIADGG 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 96/265 (36%)
NADB_Rossmann 3..248 CDD:304358 98/267 (37%)
C06E4.6NP_501154.1 FabG 3..262 CDD:223959 96/265 (36%)
NADB_Rossmann 4..266 CDD:304358 98/267 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45843
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100756
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.690

Return to query results.
Submit another query.