DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and C06E4.3

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_501156.1 Gene:C06E4.3 / 182326 WormBaseID:WBGene00015532 Length:277 Species:Caenorhabditis elegans


Alignment Length:263 Identity:106/263 - (40%)
Similarity:158/263 - (60%) Gaps:27/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSL-----KGTQAEIVVADVTK 63
            |.||.|:||:|.|||.|.|.:.|:|||.:.:.||:...|:.:|::|     ..:...||.||:|.
 Worm     6 SGKVAIITGSSFGIGRATALLFAKEGAKVTVTGRSEERLQGSKQALLDAGISDSNFLIVPADITT 70

  Fly    64 DA--DAIVQQTLAKFGRIDVLVNNAGI-----LGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVL 121
            .:  ||::.:||.|||:|::||||||.     ..:.|| |..|:.::.||..|::.||.:|:.:.
 Worm    71 SSGQDALISKTLEKFGQINILVNNAGASIADSQNRAGL-DQGIDTYEKVLKLNVQSVIEMTQKIR 134

  Fly   122 PHLLKTKGAVVNVSSCAGIRPFAGALS--YGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVT 184
            |||.||:|.:|||||.|.:: ||...:  |.::||||||:|:..|:::..||:|||:||||.|.|
 Worm   135 PHLAKTRGEIVNVSSVAALK-FAHVRNPYYPLAKAALDQYTRSAAIDLISQGIRVNTVNPGVVAT 198

  Fly   185 NIHRN-IGIVDEE----YN--GMLQRAINSHPMGRVGDVTEVAEAVAFLASSKAS-FTTGALFPI 241
            ..|.: .|:..||    |:  |..:.||   |.|..|....:|:|:||||...:| :..|.....
 Worm   199 GFHESCTGLSTEESQKFYDKVGANKSAI---PCGFSGRPEHIAKAIAFLADRDSSEYIIGQNIIA 260

  Fly   242 DGG 244
            |||
 Worm   261 DGG 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 104/261 (40%)
NADB_Rossmann 3..248 CDD:304358 106/263 (40%)
C06E4.3NP_501156.1 FabG 3..263 CDD:223959 104/261 (40%)
NADB_Rossmann 5..267 CDD:304358 106/263 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45843
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100756
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.680

Return to query results.
Submit another query.