DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and C06B8.3

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_506855.2 Gene:C06B8.3 / 182298 WormBaseID:WBGene00007369 Length:162 Species:Caenorhabditis elegans


Alignment Length:148 Identity:55/148 - (37%)
Similarity:79/148 - (53%) Gaps:13/148 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 LNTNLRGVILLTKAVLPHLLKTKGAVVNVSSCA-GIRPFAGALSYGVSKAALDQFTKIVALEMAP 169
            :..|:|.||.|.:....||:||||.::||||.| |....:....||:|||.|:.||:..|:.:..
 Worm     1 MQINMRSVITLVQKAKEHLIKTKGEIINVSSIASGPHGDSQMTYYGMSKADLNHFTRSSAISLIQ 65

  Fly   170 QGVRVNSVNPGFVVTNIHRNIGIVDEEYNGMLQRAIN---SH----PMGRVGDVTEVAEAVAFLA 227
            .|||||||:|||.:|.....:|...    |.|::.|.   ||    |.|.|....::|:.:.|||
 Worm    66 HGVRVNSVSPGFTLTGFGDAMGFPP----GALEKVIKHYASHKECIPSGVVARPGDIAQIILFLA 126

  Fly   228 S-SKASFTTGALFPIDGG 244
            . :.:|:..|.....|||
 Worm   127 DRTMSSYIIGQSIIADGG 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 53/146 (36%)
NADB_Rossmann 3..248 CDD:304358 55/148 (37%)
C06B8.3NP_506855.2 NADB_Rossmann <1..148 CDD:304358 55/148 (37%)
FabG <1..144 CDD:223959 53/146 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100756
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.680

Return to query results.
Submit another query.