DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and dhs-15

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_503754.1 Gene:dhs-15 / 178739 WormBaseID:WBGene00000978 Length:278 Species:Caenorhabditis elegans


Alignment Length:274 Identity:108/274 - (39%)
Similarity:154/274 - (56%) Gaps:32/274 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEAT-----KKSLKGTQAEIVVADVTK 63
            |:||.|:||:|||||.:.|.:||:|||.:.:.||:...::.|     |.........||:.|:.:
 Worm     5 SDKVAIITGSSSGIGRSTAVLLAQEGAKVTVTGRSSEKIQETVNEIHKNGGSSDNINIVLGDLNE 69

  Fly    64 D--ADAIVQQTLAKFGRIDVLVNNAGIL-----GKGGLIDLDIEEFDAVLNTNLRGVILLTKAVL 121
            .  .|.:::.||::||:||:|:||||..     ||.| .:..|..||.::..|||.|:.|.|...
 Worm    70 SECQDELIKSTLSRFGKIDILINNAGAAFADPSGKIG-SEAAIGIFDDMMKLNLRSVVELVKKCR 133

  Fly   122 PHLLKTKGAVVNVSS-CAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTN 185
            |||:.:||.:||||| .||.:|:.....||:.||.|||.|:.:|||:.|..||||||:||.:.||
 Worm   134 PHLIASKGEIVNVSSIAAGPQPYIYYTYYGICKAGLDQLTRSLALELIPFDVRVNSVSPGLISTN 198

  Fly   186 IHRNIGIVD------EEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKAS-FTTGALFPIDG 243
            ....:|:.|      |||....:..|   |.||.|...|:|..:||||..|:| :..|....|||
 Worm   199 FLGAVGMGDDVVKKTEEYYSTHRDCI---PAGRTGKPEEIASLIAFLADRKSSAYIIGQSIVIDG 260

  Fly   244 G--------KHNLT 249
            |        .|:|:
 Worm   261 GTTLVLGMPSHDLS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 104/259 (40%)
NADB_Rossmann 3..248 CDD:304358 107/271 (39%)
dhs-15NP_503754.1 FabG 2..261 CDD:223959 104/259 (40%)
NADB_Rossmann 4..265 CDD:304358 106/263 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45843
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100756
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.690

Return to query results.
Submit another query.