DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and dhs-9

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_498146.1 Gene:dhs-9 / 175737 WormBaseID:WBGene00000973 Length:319 Species:Caenorhabditis elegans


Alignment Length:284 Identity:88/284 - (30%)
Similarity:127/284 - (44%) Gaps:56/284 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGTQAEIVVADVTKDA 65
            |||:.::.||||||.|||..||..|...|||:.:.||.......:|..|.|.:|         .|
 Worm     1 MSLAGQIAIVTGASRGIGRGIALQLGEAGATVYITGRKPEESLNSKVGLSGLEA---------TA 56

  Fly    66 DAIVQ---QTLAKF---------------------GRIDVLVNNA--GI------LGKGGLIDLD 98
            |.|.:   :.:|:|                     |::|:|||||  |:      :|| ...:.|
 Worm    57 DEITKRGGKGIARFVDHQNMEEVKNFFEVVEKEHQGQLDILVNNAYQGVTAISENMGK-PFYETD 120

  Fly    99 IEEFDAVLNTNLRGVILLT-KAVLPHLLKTKGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKI 162
            ...:|.:.|..||.....| .|......:.||.:|||||..|:| :...::|||.|.|||:.:..
 Worm   121 PYVWDTINNVGLRNHYFCTVYAARLMTARNKGLIVNVSSGGGLR-YLFNVAYGVGKQALDRMSAD 184

  Fly   163 VALEMAPQGVRVNSVNPGFVVTNIHRNIGIVDEEY---NGMLQRAINSHPMGRVGDVTEV-AEAV 223
            .|:|:..:.|.|.|:.||.|.|.      :||:.:   ||..:..|.:..:...|:..|. ..||
 Worm   185 TAVELRKKNVCVVSIWPGAVRTE------LVDKMFKDENGKPRPEIKNAEVFANGETVEYPGRAV 243

  Fly   224 AFLASS--KASFTTGALFPIDGGK 245
            ..|||.  :...|...|...|.||
 Worm   244 VSLASDPRRMDKTGRILITEDLGK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 86/281 (31%)
NADB_Rossmann 3..248 CDD:304358 86/282 (30%)
dhs-9NP_498146.1 PRK08303 1..279 CDD:236229 88/284 (31%)
NADB_Rossmann 3..276 CDD:304358 86/282 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.