DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and Y47G6A.21

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001021764.1 Gene:Y47G6A.21 / 171924 WormBaseID:WBGene00021646 Length:255 Species:Caenorhabditis elegans


Alignment Length:253 Identity:123/253 - (48%)
Similarity:167/253 - (66%) Gaps:8/253 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VVIVTGASSGIGAAIAQVLAREGATLALVGRN------VANLEATKKSLKGTQAEIVVADVTKD- 64
            |.|:||||||||...|.:.|::...|:|.|||      ||.|..::.::......|...:::.| 
 Worm     3 VAIITGASSGIGKGTALLFAKKKYQLSLTGRNTDSLKEVAALCISEGAISADDILITAVELSSDE 67

  Fly    65 -ADAIVQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPHLLKTK 128
             ..|||..|:.||||||.|:|:||||..|.::|..||.:|.::|.|:|.:|.||:|.|||::.||
 Worm    68 APKAIVDATVQKFGRIDSLINSAGILRAGPVLDSGIEVYDELMNVNVRSLIRLTRAALPHIITTK 132

  Fly   129 GAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIHRNIGIV 193
            |.||||||..|..||||...|.:||:|:|||||.:||||||.|||||:|.||.:||||||..|..
 Worm   133 GTVVNVSSINGPCPFAGVTYYCMSKSAVDQFTKCLALEMAPNGVRVNAVCPGVIVTNIHRASGQD 197

  Fly   194 DEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGGKHNLTPR 251
            :..|...|:::..:|.:||.|..:|||||:.||:|.|:|||||.|..:|||:..:.||
 Worm   198 EATYAAFLEKSKTTHALGRPGTTSEVAEAILFLSSEKSSFTTGQLLKVDGGRGIMHPR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 119/244 (49%)
NADB_Rossmann 3..248 CDD:304358 121/248 (49%)
Y47G6A.21NP_001021764.1 FabG 1..249 CDD:223959 120/245 (49%)
NADB_Rossmann 3..252 CDD:304358 121/248 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167333
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45843
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43975
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.