DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and R119.3

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_490726.1 Gene:R119.3 / 171628 WormBaseID:WBGene00020089 Length:253 Species:Caenorhabditis elegans


Alignment Length:259 Identity:84/259 - (32%)
Similarity:128/259 - (49%) Gaps:38/259 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IVTGASSGIGAAIAQVLAREGATLAL-------VGRNVA--NL----EATKKSLKGTQAEIVVAD 60
            :|.||:|.:|.|:.:.||..|..:|.       ||: ||  |:    :.|..||....||.....
 Worm     5 LVIGATSTLGKAVVRRLAFTGYKVAAAADCPNSVGK-VAEDNIKVGGDVTAFSLDVANAEHRKEL 68

  Fly    61 VTKDADAIVQQTLAKFGRIDVLV----NNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVL 121
            :||.|:        |.|.:|.|:    .|. :||:  :|:...|:||.:...||.....|::|.:
 Worm    69 ITKVAE--------KLGGLDTLIIVPPQNE-VLGE--IIETSGEDFDKLFANNLTTPFRLSQAAM 122

  Fly   122 PHLLKTK-GAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTN 185
            ..|.|:: |:::.::||.|..|......|.|:.:::...||.||...|.||||||||..|.:..:
 Worm   123 STLAKSQNGSIIYLTSCFGFTPSIDMGLYSVASSSVLSLTKSVAQSAAKQGVRVNSVVSGMIEGD 187

  Fly   186 IHRNIGIVDEEYNGMLQRAINSH-----PMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGG 244
               ..|.|.:..:|...|.|..|     |:||:|..::||..|.||||:||.:.||....:.||
 Worm   188 ---GTGAVWDHASGEEARQIKQHLESMIPLGRLGRPSDVASYVEFLASTKARYITGENCIVGGG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 82/257 (32%)
NADB_Rossmann 3..248 CDD:304358 84/259 (32%)
R119.3NP_490726.1 fabG 4..249 CDD:235500 84/259 (32%)
SDR_c 4..241 CDD:212491 81/250 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.