DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and DECR1

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001350.1 Gene:DECR1 / 1666 HGNCID:2753 Length:335 Species:Homo sapiens


Alignment Length:270 Identity:75/270 - (27%)
Similarity:122/270 - (45%) Gaps:42/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLK---GTQAEIVVADVTK 63
            |...||..:||..:|:|..:..:|:..||...:..|.:..|:||.:.:.   |.:...:..|| :
Human    56 SFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDV-R 119

  Fly    64 DADAIVQQTLAKF----GRIDVLVNNAGILGKGGLID----LDIEEFDAVLNTNLRGVILLTKAV 120
            |.| :||.|:::.    |..::::|||.    |..|.    |....:..:.:..|.|...:|..:
Human   120 DPD-MVQNTVSELIKVAGHPNIVINNAA----GNFISPTERLSPNAWKTITDIVLNGTAFVTLEI 179

  Fly   121 LPHLLKT-KGA----VVNVSSCAG---IRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSV 177
            ...|:|. |||    :..:.:..|   :.|.|.|      ||.::..:|.:|.|....|:|.|.:
Human   180 GKQLIKAQKGAAFLSITTIYAETGSGFVVPSASA------KAGVEAMSKSLAAEWGKYGMRFNVI 238

  Fly   178 NPGFVVTN--IHR--NIGIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGAL 238
            .||.:.|.  ..|  ..|..::|..|.:       |.||:|.|.|:|...|||.|..||:..||:
Human   239 QPGPIKTKGAFSRLDPTGTFEKEMIGRI-------PCGRLGTVEELANLAAFLCSDYASWINGAV 296

  Fly   239 FPIDGGKHNL 248
            ...|||:..|
Human   297 IKFDGGEEVL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 72/264 (27%)
NADB_Rossmann 3..248 CDD:304358 73/267 (27%)
DECR1NP_001350.1 TER_DECR_SDR_a 57..303 CDD:187627 72/264 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.