DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and H2-Ke6

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_038571.2 Gene:H2-Ke6 / 14979 MGIID:95911 Length:259 Species:Mus musculus


Alignment Length:260 Identity:86/260 - (33%)
Similarity:138/260 - (53%) Gaps:24/260 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSL----------KGTQAE 55
            :.|.:.:.:||||.||||.||:..||.|||.:|....:.|..:.|.:.|          :|..|.
Mouse     5 LRLRSALALVTGAGSGIGRAISVRLAAEGAAVAACDLDGAAAQDTVRLLGSPGSEDGAPRGKHAA 69

  Fly    56 IVVADVTKD--ADAIVQQTLAKFGR-IDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLT 117
            . .|||::.  |..::::..|.|.| ..|:|:.|||.....|:.:..|::|.|:..||:|..|:|
Mouse    70 F-QADVSQGPAARRLLEEVQACFSRPPSVVVSCAGITRDEFLLHMSEEDWDRVIAVNLKGTFLVT 133

  Fly   118 KAVLPHLLKT--KGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPG 180
            :|....|:.:  :|:::|:||..|.....|..:|..|||.:...|:..|.|:...|:|.|||.||
Mouse   134 QAAAQALVSSGGRGSIINISSIIGKVGNIGQTNYASSKAGVIGLTQTAARELGRHGIRCNSVLPG 198

  Fly   181 FVVTNIHRNI-GIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGG 244
            |:.|.:.:.: ..|.::...|:       |:|.:||..:||:.||||||..:.:.|||...:.||
Mouse   199 FIATPMTQKMPEKVKDKVTAMI-------PLGHMGDPEDVADVVAFLASEDSGYITGASVEVSGG 256

  Fly   245  244
            Mouse   257  256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 84/258 (33%)
NADB_Rossmann 3..248 CDD:304358 86/258 (33%)
H2-Ke6NP_038571.2 NADB_Rossmann 11..258 CDD:304358 85/254 (33%)
fabG 12..259 CDD:235546 85/253 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.