DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and Cbr3

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_766635.1 Gene:Cbr3 / 109857 MGIID:1309992 Length:277 Species:Mus musculus


Alignment Length:247 Identity:65/247 - (26%)
Similarity:102/247 - (41%) Gaps:63/247 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLSNKVVIVTGASSGIGAAIAQVLARE-GATLALVGRN-------VANLEATKKSLKGTQAEIV 57
            ||..::|.:||||:.|||.||.:.|.|: ...:.|..|:       |..|:|...|.:..|.:| 
Mouse     1 MSSCSRVALVTGANKGIGFAITRDLCRKFSGDVVLTARDEARGRAAVQQLQAEGLSPRFHQLDI- 64

  Fly    58 VADVTKDADAIVQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLP 122
              |..:...|:......::|.::||||||||..:   :| |...||......|:.....|:.|..
Mouse    65 --DDPQSIRALRDFLRKEYGGLNVLVNNAGIAFR---MD-DPTPFDIQAEVTLKTNFFATRNVCT 123

  Fly   123 HLL---KTKGAVVNVSSCAGIRPFAGA-------------------------------------- 146
            .||   |..|.|||:||..|::.....                                      
Mouse   124 ELLPIMKPHGRVVNISSLQGLKALENCREDLQEKFRCDTLTEVDLVDLMKKFVEDTKNEVHEREG 188

  Fly   147 ---LSYGVSKAALDQFTKIVALEM----APQGVRVNSVNPGFVVTNIHRNIG 191
               .:|||||..:...|:|:|.::    ....:.:|:..||:|.|::.|:.|
Mouse   189 WPDSAYGVSKLGVTVLTRILARQLDEKRKADRILLNACCPGWVKTDMARDQG 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 65/247 (26%)
NADB_Rossmann 3..248 CDD:304358 63/245 (26%)
Cbr3NP_766635.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 63/242 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830559
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.