Sequence 1: | NP_569875.2 | Gene: | CG3699 / 31046 | FlyBaseID: | FBgn0040349 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_766635.1 | Gene: | Cbr3 / 109857 | MGIID: | 1309992 | Length: | 277 | Species: | Mus musculus |
Alignment Length: | 247 | Identity: | 65/247 - (26%) |
---|---|---|---|
Similarity: | 102/247 - (41%) | Gaps: | 63/247 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSLSNKVVIVTGASSGIGAAIAQVLARE-GATLALVGRN-------VANLEATKKSLKGTQAEIV 57
Fly 58 VADVTKDADAIVQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLP 122
Fly 123 HLL---KTKGAVVNVSSCAGIRPFAGA-------------------------------------- 146
Fly 147 ---LSYGVSKAALDQFTKIVALEM----APQGVRVNSVNPGFVVTNIHRNIG 191 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3699 | NP_569875.2 | fabG | 1..244 | CDD:235546 | 65/247 (26%) |
NADB_Rossmann | 3..248 | CDD:304358 | 63/245 (26%) | ||
Cbr3 | NP_766635.1 | carb_red_PTCR-like_SDR_c | 6..277 | CDD:187585 | 63/242 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167830559 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |