DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and DHRS4

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_066284.2 Gene:DHRS4 / 10901 HGNCID:16985 Length:278 Species:Homo sapiens


Alignment Length:254 Identity:90/254 - (35%)
Similarity:142/254 - (55%) Gaps:14/254 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGTQAEI--VVADVTK-- 63
            |:|||.:||.::.|||.|||:.||::||.:.:..|...|::....:|:|....:  .|..|.|  
Human    30 LANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAE 94

  Fly    64 DADAIVQQTLAKFGRIDVLVNNAGILG-KGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPHLLKT 127
            |.:.:|...:...|.||:||:||.:.. .|.::|:..|.:|..|:.|::...|:||||:|.:.|.
Human    95 DRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKR 159

  Fly   128 -KGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIHRNIG 191
             .|:||.|||.|...|..|...|.|||.||...||.:|:|:||:.:|||.:.||.:.|:..|.:.
Human   160 GGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLW 224

  Fly   192 IVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGGKHNLTP 250
             :|:|....::..:.   :.|:|:..:.|..|:||.|..||:.||....:.||    ||
Human   225 -MDKEKEESMKETLR---IRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGG----TP 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 86/246 (35%)
NADB_Rossmann 3..248 CDD:304358 88/250 (35%)
DHRS4NP_066284.2 CR_SDR_c 23..278 CDD:187641 90/254 (35%)
fabG 30..273 CDD:235975 86/246 (35%)
Microbody targeting signal 276..278 90/254 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140588
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.