DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and DHRS2

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_878912.1 Gene:DHRS2 / 10202 HGNCID:18349 Length:300 Species:Homo sapiens


Alignment Length:241 Identity:81/241 - (33%)
Similarity:127/241 - (52%) Gaps:9/241 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGTQAEI--VVADVTK-- 63
            |:|:|.:|||::||||.|||:.|||:||.:.:..|...|::.....|:|....:  :|..|.|  
Human    34 LANRVAVVTGSTSGIGFAIARRLARDGAHVVISSRKQQNVDRAMAKLQGEGLSVAGIVCHVGKAE 98

  Fly    64 DADAIVQQTLAKFGRIDVLVNNAGILG-KGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPHLLKT 127
            |.:.:|.:.|...|.:|.||.:||:.. .|..:....:.:|.:|:.|::...||...:||::...
Human    99 DREQLVAKALEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQLLPYMENR 163

  Fly   128 KGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIHR--NI 190
            :|||:.|||.|...|......|.|||.||...|:.:|||:||:.:|||.|.||.:.|:..:  .|
Human   164 RGAVILVSSIAAYNPVVALGVYNVSKTALLGLTRTLALELAPKDIRVNCVVPGIIKTDFSKVVRI 228

  Fly   191 GIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTG 236
            |.:....:|...|.|.|  ...:|....|.|:....|....:.:||
Human   229 GFMGMSLSGRTSRNIIS--CRGLGSQRTVQESCPSCALQMPATSTG 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 81/241 (34%)
NADB_Rossmann 3..248 CDD:304358 81/241 (34%)
DHRS2NP_878912.1 SDR 27..>226 CDD:330230 69/191 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140594
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.