DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and hsd17b14

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_002935043.1 Gene:hsd17b14 / 100498205 XenbaseID:XB-GENE-986127 Length:276 Species:Xenopus tropicalis


Alignment Length:246 Identity:78/246 - (31%)
Similarity:132/246 - (53%) Gaps:8/246 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGT---QAEIVVADVTKDAD 66
            ::|.::||.:.|||.|:.:...:.||.:....:: ...:|.:..:|..   ....|..||||:.|
 Frog    14 DRVAVITGGTKGIGEAMVKEFVKSGARVVFCSKD-TEAKALENEIKAAGPGDCIYVCCDVTKEED 77

  Fly    67 --AIVQQTLAKFGRIDVLVNNAGILGKGGLID-LDIEEFDAVLNTNLRGVILLTKAVLPHLLKTK 128
              .:::.|:..:|:||.|:||||.......|| ...::|..:||.||.|..|..|..||||.||:
 Frog    78 IKKLIEITVMNYGQIDCLINNAGWHPPEQTIDGTSADDFRDLLNLNLIGYFLTAKYALPHLRKTQ 142

  Fly   129 GAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIHRNIGIV 193
            |.::|:||..||.....|:.|..:|.|:...||.:|::.:...||:||::||.:.|.:...:...
 Frog   143 GNIINISSLVGIIGQKHAIPYVATKGAVTAMTKAMAVDESRHNVRINSISPGNIWTPLWEELSSH 207

  Fly   194 DEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGG 244
            .:....|:|..|::..:||:|...|.|:|..:|| ::.:|.||....:.||
 Frog   208 SKNSEAMIQGGIDAQLLGRMGTAEECAKAALYLA-AEGTFCTGIDLLLTGG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 76/244 (31%)
NADB_Rossmann 3..248 CDD:304358 78/246 (32%)
hsd17b14XP_002935043.1 NADB_Rossmann 6..265 CDD:389744 78/246 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.