DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3699 and hsdl1

DIOPT Version :9

Sequence 1:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_002937365.1 Gene:hsdl1 / 100489686 XenbaseID:XB-GENE-989915 Length:322 Species:Xenopus tropicalis


Alignment Length:179 Identity:49/179 - (27%)
Similarity:88/179 - (49%) Gaps:9/179 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSL---KGTQAEIVVADVTKDADAI-- 68
            :||||:|||..|.|:.|||.|..:.||..|...|:....|:   .|.....:..|..|..:|.  
 Frog    71 VVTGATSGIAQAYAEELARCGMNVVLVDNNREKLQKMSDSITATHGVNTSFIEVDFCKGHEAYRP 135

  Fly    69 VQQTLAKFGRIDVLVNNAG--ILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPHLL-KTKGA 130
            ::..| :...:.:|||..|  :.....:|:...|:...:::.::....::.|.|:|.:. :.:||
 Frog   136 IKDAL-RHVEVGILVNCVGNFLEYPQSVIECPEEQLWKIIHVSVSAATIMAKIVVPGMAQRRRGA 199

  Fly   131 VVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNP 179
            :||||..:..:|......|...:..:|.|||.:..|::.:|:.|.|:.|
 Frog   200 IVNVSFRSCCKPNFPMTMYTPCQLYMDGFTKELQSELSSKGIFVQSLTP 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3699NP_569875.2 fabG 1..244 CDD:235546 49/179 (27%)
NADB_Rossmann 3..248 CDD:304358 49/179 (27%)
hsdl1XP_002937365.1 17beta-HSD1_like_SDR_c 67..309 CDD:187614 49/179 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.