DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3703 and TBC1D5

DIOPT Version :9

Sequence 1:NP_569874.1 Gene:CG3703 / 31045 FlyBaseID:FBgn0040348 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_731780.1 Gene:TBC1D5 / 41628 FlyBaseID:FBgn0038129 Length:654 Species:Drosophila melanogaster


Alignment Length:467 Identity:90/467 - (19%)
Similarity:162/467 - (34%) Gaps:136/467 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 EEQELLTSSLLALTSHFAHVQLRVRQIVEAPAEERD------QLLRDLEDFAFQGIPDAVQSKES 155
            :.|.||..|.||.|.    :...:..:::....|.|      :|:..:|  ::..:.:.|.:...
  Fly   207 DHQSLLHFSELAKTD----INPTLLDVLDPAYLEADTYSLFSRLMASVE--SYYRVSNLVSTPGG 265

  Fly   156 HPDKPA-SDGEKDHGPDSQLIQQLK----SQLTELEQIAYEAGEPGILPQHV-------LLEKQK 208
            |.::.| |.|:.:...::::|.||.    ..|.:.:|..:...:...:|.|:       ||..::
  Fly   266 HIEQRAESPGDNETSTEAEVIGQLNFIRDKILAKQDQHLHHYLQKMEIPLHIFGIRWLRLLFGRE 330

  Fly   209 FILDEL----------------------------RAKLNLQ--------------------VEQH 225
            |:|.:|                            |.||.|.                    |.:|
  Fly   331 FMLLDLLLLWDAIFADSDRFDLPNYILVAMLVHIRDKLLLSDYTTSLTYLMRYPNNVDVHLVLRH 395

  Fly   226 ELPALSTEQLRH-------------QVDNAIGEFVGPLKMKEQLVAQLKTQITDLERFIAFLQ-- 275
            .|..|:.:|..:             ..|..:....|.........:.:.|..:.::|.|.|:|  
  Fly   396 ALFMLNPKQFEYPPNAFTCVSFANSSADKDVPPPAGQRPRTNSENSSMATSGSQIDRQITFMQER 460

  Fly   276 --CD-------------AIEGSVGDRLKLLS-GAYNSYAAKQTARSSQASYVATNAPATTATTPP 324
              .|             |::|.:.:..:||. ...|:....:.|||...||::|          .
  Fly   461 NAADSSALAKLQDTHRVAMDGYLENSPELLRLELKNAQTVIKIARSKLQSYLST----------V 515

  Fly   325 SSGLGAHSSG-ESLHSKAHGLLDKASVL--MQMFASTHLVKP-----RTHDEFQQNSLKKTHKGN 381
            ...:|..::| |.|.....|:.:..|.|  ..||.......|     ..:::.|.|::.|..|  
  Fly   516 RHHVGKQANGSEELGRTLDGIEELCSFLDVKFMFPLHQRSAPIDQALEANEQKQLNTVSKPPK-- 578

  Fly   382 HWGDLRAQLEVDIQEVAALAATLSCDREKLA----NIKRALRKQQQQAESTEFSD--TGNPVINS 440
                 ...........|||:||......:.|    :::|.|.:.::...||..||  .||.|:  
  Fly   579 -----PTASSTPANAPAALSATGGYQMPENAFMHSSMRRLLGELREIELSTITSDEKPGNAVV-- 636

  Fly   441 QNGALTLPPRCR 452
            |||.....|:.|
  Fly   637 QNGLPAAEPQQR 648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3703NP_569874.1 RUN 516..703 CDD:280855
TBC1D5NP_731780.1 TBC <150..369 CDD:214540 30/167 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.