DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3703 and plx

DIOPT Version :9

Sequence 1:NP_569874.1 Gene:CG3703 / 31045 FlyBaseID:FBgn0040348 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_001163511.1 Gene:plx / 40704 FlyBaseID:FBgn0261261 Length:1572 Species:Drosophila melanogaster


Alignment Length:463 Identity:93/463 - (20%)
Similarity:145/463 - (31%) Gaps:157/463 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 HGPDSQLI----QQLKS---QLTELEQIAYEAGEP--------GILPQHVLLEKQKF--ILDELR 215
            |.|.::.|    .||||   |.:....:|...|..        |:  :|.|.....:  :.....
  Fly    76 HKPQAKSIGNGFLQLKSSAGQTSSSSAVASSMGGAASSSLTGNGL--RHTLTASTSYGSLSSSAA 138

  Fly   216 AKLNLQVEQHELPALSTEQLRHQVDNAIGEFVGPLKMKEQLVAQLKTQITDLERFIAFLQCDAIE 280
            ....||::|      |.|....|..|.: ||.||:.....|:...|..:..:..|    :|:|:|
  Fly   139 CAYQLQLQQ------SAEASAEQPQNFM-EFQGPITGLVYLLKDPKDPLLHIYLF----ECEAVE 192

  Fly   281 -----------------GSVGDRLKLL-----------SGAYNSYAAKQTARSSQASYVATNAPA 317
                             ||||...:.|           :||.|...| ..|.:.:.|....||..
  Fly   193 EMAELMHQMRDPAHTLGGSVGSIPQTLIGGGGGSHGNSNGALNGIHA-TPATNLKMSEAMRNAQH 256

  Fly   318 TTATTPPSSGLGAHSSGESLHSKAHGLLDKASVL-----------MQMFAS-----THL------ 360
            .|:..|.||.:.|..      |..|||...:..:           :.:.|.     ||.      
  Fly   257 DTSPNPVSSKMKASK------SYTHGLSSSSGTVNIPTSTSAQSNLSLLADISPNHTHFFEVMYV 315

  Fly   361 -------------------------------------------------VKP----RTHD-EFQQ 371
                                                             .||    ::|| :.:.
  Fly   316 GKIRVSQKRVPNTFIDDALPKFKAYDAQRLRLLQNRKMSLSSEGGVGIEAKPSSSLKSHDLKEED 380

  Fly   372 NSLKKTHKGNHWG-DLRA----QLEVDIQEVAALAATLSCDREKLANIKRALRKQQQQAE--STE 429
            ...::.|||:... |.:|    ||::...|..|....|..::|..:..||.|.:.|.|.|  ..|
  Fly   381 EEEQEQHKGHDDSQDSQAKPLVQLQLTGAEEGAAPRPLEDNKENKSPEKRPLLRGQSQIELGHKE 445

  Fly   430 FSDTGNPVINSQNGALTLPPRCRRAVPTGHELAPYASG---GAISSDSDEDISYSNFEWEKESKS 491
            .||...|:  :.|..|..|.......||    .|...|   |..|:.:.....:.|:..:...|.
  Fly   446 HSDGSQPL--AANSQLEAPNVIVNKQPT----PPRDQGVGTGTASASAGPSQLHPNYAMDNIPKQ 504

  Fly   492 RRTTHARG 499
            |..:.::|
  Fly   505 RDRSASQG 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3703NP_569874.1 RUN 516..703 CDD:280855
plxNP_001163511.1 PTB_TBC1D1_like 301..601 CDD:269967 40/218 (18%)
DUF3350 835..880 CDD:288663
TBC 933..1152 CDD:214540
RILP-like <1176..1267 CDD:304877
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.