DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3703 and CG7324

DIOPT Version :9

Sequence 1:NP_569874.1 Gene:CG3703 / 31045 FlyBaseID:FBgn0040348 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_649305.1 Gene:CG7324 / 40361 FlyBaseID:FBgn0037074 Length:1291 Species:Drosophila melanogaster


Alignment Length:532 Identity:107/532 - (20%)
Similarity:176/532 - (33%) Gaps:164/532 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 QIVEAPAEERDQLLRDLED----FAFQGIPDAVQSKESHPDKPASDGEK---------------- 166
            ||:|   ..||:||...:|    ...|...:.|.:.| :...|.:|..|                
  Fly   660 QIIE---WNRDKLLICQDDGEAMLVLQNYLEGVYNPE-YQVPPTTDKRKMERKVQTQTVQTLIHE 720

  Fly   167 ---DHGPD--SQLIQQLKSQLTELEQIAYEA-GEPGILPQHVLLEKQKFILDELRAKLN-LQVEQ 224
               ..|.|  .|.|::|:::...|....::. .|..|:..:|  :...|...||...|. ::.|:
  Fly   721 AYTKFGEDITQQRIEELRNKHRRLTMRQFDIDNEKTIVKAYV--QNPYFNRSELHMLLTIIREEK 783

  Fly   225 HELPALSTEQLRHQVDNAIGEFVGPLKMKEQLVAQLKTQ-ITDLERFIAFLQCDAIEGSVGDRLK 288
            |.|.:|..:|.:.|.         ||....|||.|..:: |.|             .|:.|.|.:
  Fly   784 HALKSLQQQQQKVQC---------PLSETPQLVPQSTSRPIQD-------------AGASGGRYE 826

  Fly   289 LLSGAYNSYAAKQTARSSQASYVATNAPATTATTPPSSGLGAHSSGESLHSKAHGLL--DKASVL 351
            ..|.:|..:....|..:.....|:.:............|.|....|:.::  |.||:  :|....
  Fly   827 AYSVSYEVFHTLFTELTPWRKCVSVDIGEKLFRLTDKKGTGVLDFGQLIN--ALGLVCSNKNMEK 889

  Fly   352 MQMFASTHL--------------VKPRTHDEFQQ------------------------------- 371
            :::....||              .:|||.|:.::                               
  Fly   890 LKLLYVLHLPPLLSKAEIERSRRPRPRTKDDAEEAFEAEDFFDNDASESMEALPSPSDHNFDADD 954

  Fly   372 ----NSLKKTH-----KGNHWGDL------------------RAQLEVDIQEVAALAATLSCDRE 409
                ::.:..|     .||.:.||                  .:...||:......|.:....|:
  Fly   955 FALISATQHLHNLAGISGNTFMDLSRTPNLSVNSNTSSLAHRSSTFYVDLPGFQGTATSTDAGRD 1019

  Fly   410 KLANIKRALRKQQQQAESTEFSDTGNPVINSQNGALTLPPRCRRAVPTGHELAPYASGGAISSDS 474
            : ..::|.||:|.:......|||.      |..||..:.|      |.....|...:|.|.|:.:
  Fly  1020 E-DELQRQLRQQGRYESIDTFSDI------SDLGAARITP------PEAGVGADVVAGAASSAAA 1071

  Fly   475 DEDI----SYSNFEWEKESKSRRTTHARGDSIATIGRELTTVVRKNFARTLQQLIQHGLRIPAES 535
            |..:    :.|||. :.......|...|.||.||..|.|         .:|..|:..    |.|.
  Fly  1072 DHMLLNVETISNFS-QISDLVAATRLERVDSNATDLRSL---------GSLGYLLDQ----PDEG 1122

  Fly   536 AASSL-MVPFMR 546
            |::|. .:|.||
  Fly  1123 ASNSQHSIPHMR 1134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3703NP_569874.1 RUN 516..703 CDD:280855 9/32 (28%)
CG7324NP_649305.1 PH-GRAM1_TCB1D8_TCB1D9_family 147..249 CDD:275404
PH-GRAM2_TCB1D9_TCB1D9B 293..389 CDD:270161
TBC 462..670 CDD:214540 5/12 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.