DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3703 and RN-tre

DIOPT Version :9

Sequence 1:NP_569874.1 Gene:CG3703 / 31045 FlyBaseID:FBgn0040348 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_652381.1 Gene:RN-tre / 36554 FlyBaseID:FBgn0020620 Length:571 Species:Drosophila melanogaster


Alignment Length:396 Identity:69/396 - (17%)
Similarity:120/396 - (30%) Gaps:153/396 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 LALTSHFAHVQLRVRQIVEAPAEERDQLLRDLEDFAFQGIPDAVQSKESHPDKPASDGEKDHG-P 170
            :|:|..:.|               :|:||| |:|  ...|.:.:|.:.          .|:.| .
  Fly   302 MAITILYLH---------------KDELLR-LKD--MDAIIEYLQVRL----------HKNFGYS 338

  Fly   171 DSQLIQQLKSQLTELEQIAYEAGEPGILPQHVLLEKQKFILDELRAKLNLQVEQHELPALSTEQL 235
            |...||.|:..:.:|:.:..:...|                    ||.|      |.|.      
  Fly   339 DDDAIQALERVMKKLKDLKLDVPPP--------------------AKSN------EFPT------ 371

  Fly   236 RHQVDNAIGEFVGPLKMKEQLVAQLKTQITDLERFIAFLQCDAIEGSVGDRLKLLSGAYNSYAAK 300
                 ..:|:||.  ...|:.:.:.:...||.|:.:.   .|.|.....:.:.:.|..  ||...
  Fly   372 -----RKLGDFVE--ADMEKKIGRRRNDYTDAEKQVI---TDVISRQEQNAIDVQSTV--SYETS 424

  Fly   301 QTARSSQASYVATNAPATTATTPPSSGLGAHSSG---------------ESLHSKAHGLLDKASV 350
            :.|.....|.....:..:.||:|.:|....:|:|               :|:|:.:         
  Fly   425 ECATGDGYSMKTFESITSLATSPANSSYSLYSNGFVVTTIDSEQDPARSQSIHNLS--------- 480

  Fly   351 LMQMFASTHLVKPRTHDEFQQNSLKKTHKGNHWGDLRAQLEVDIQEVAALAATLSCDREKLANIK 415
                :..||...|....:..::|........:..||...|||                       
  Fly   481 ----YLQTHPALPPNGLQHMRHSFSSDSDSRNRIDLDQALEV----------------------- 518

  Fly   416 RALRKQQQQAESTEFSDTGNPVINSQNGALTLPPRCRRA-----VPTGHELAPYASGGAISSDSD 475
              |::||                      |.|.|:...:     |..|.....|..|...::|.|
  Fly   519 --LQRQQ----------------------LPLHPKTPSSQVVYIVQNGGGGGRYMDGHRDAADDD 559

  Fly   476 EDISYS 481
            :|.:.|
  Fly   560 DDDALS 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3703NP_569874.1 RUN 516..703 CDD:280855
RN-treNP_652381.1 TBC 100..315 CDD:214540 4/27 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.