DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mus81 and ercc4

DIOPT Version :9

Sequence 1:NP_569873.1 Gene:mus81 / 31044 FlyBaseID:FBgn0040347 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_956079.1 Gene:ercc4 / 327322 ZFINID:ZDB-GENE-030131-5533 Length:886 Species:Danio rerio


Alignment Length:189 Identity:44/189 - (23%)
Similarity:72/189 - (38%) Gaps:51/189 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LIDEELRHHRGLQ---------------LLPQEAVVQERY----EQQVQAVVRKVQEK--QLEHQ 114
            |.|.||...|.|:               |:...:..::||    .::.||....::||  .:..:
Zfish   551 LYDAELSFVRQLEIYKACRPGKPLRVYFLIYGGSTEEQRYLTALNKEKQAFEHLIREKASMVVPE 615

  Fly   115 KRQNKCDRPRKLTKKDLAELAALEERERVVRMKPGQFQLLLLVDTQETSGKNKRVLD--QTRSYL 177
            :|:.:.|....|.:......||...|      |.|        ..:|....::.::|  :.||.|
Zfish   616 EREGREDTNLDLVRSQEPASAATNTR------KAG--------GLEEVKEPHRIIVDMREFRSEL 666

  Fly   178 ESL----GARHEVRRLTIGDFLWVAQDQEGNELVLPYIVERKRMDDLASSIRDGRFHEQ 232
            .||    |...|...|.:||::          |.....||||.:.||..|::.||.:.|
Zfish   667 PSLLHRRGLDIEPVTLEVGDYI----------LTSDICVERKSVSDLIGSLQSGRLYTQ 715

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mus81NP_569873.1 NT_Pol-beta-like 16..>96 CDD:299849 9/43 (21%)
ERCC4 157..295 CDD:280828 23/82 (28%)
ercc4NP_956079.1 rad1 87..874 CDD:273163 44/189 (23%)
ERCC4 657..787 CDD:280828 22/69 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1948
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.