DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3704 and CG2656

DIOPT Version :9

Sequence 1:NP_569872.1 Gene:CG3704 / 31043 FlyBaseID:FBgn0040346 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_649699.1 Gene:CG2656 / 40857 FlyBaseID:FBgn0037478 Length:283 Species:Drosophila melanogaster


Alignment Length:332 Identity:85/332 - (25%)
Similarity:135/332 - (40%) Gaps:72/332 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LVLGMAGSGKTTFTQKLIQHAQE-KFNPYVVNLDPACREVPYAAHVDIRDTVNYREVMKQYQL-- 88
            :::|.|||||:|:...:.|:|.: |.|..|||||||.....|....||||.::..:.|:..:|  
  Fly     6 IIVGPAGSGKSTYCSLMQQYAMDCKRNVQVVNLDPAAEHFTYNPLTDIRDLIHLDDAMEDEELHY 70

  Fly    89 GPNGGIVTALNMFTTKMAQFAELV------RRAGERGHKWCVIDTPGQIEVFNWSASGSIITEGL 147
            |||||::..|...........|.:      ...||....:.:.|.|||||:|.....|..:.|.|
  Fly    71 GPNGGLIFCLEFLIENQEWLKEQLCGGENELMVGEPDDDYILFDMPGQIELFTHLKMGRQLVELL 135

  Fly   148 ATM-FPTIVVYVMDVERSACPTTFMSNMLYACSILYKTRLPFLVALNKIDLKDCGFVMDWMTDFE 211
            .:. |.|.||:.:|.:.......|:|..:.|.|::.....|.:..|.|:||    ...|.....|
  Fly   136 ESWNFRTCVVFCLDSQFMVDGAKFISGTMAALSVMANMEQPHINVLTKVDL----LSSDARKQLE 196

  Fly   212 AFQEAQEEEHSFVSNLTRTMSLTLDTFYENLRTCGVSAKTGVGFTQLLTKILESVDEYETDYKPV 276
            .:.|  .:.||.:..||                      .|.||.:...|:.:::.....|:..|
  Fly   197 MYLE--PDAHSLMGELT----------------------IGTGFGEKYAKLTQAIGALIEDFSLV 237

  Fly   277 YEKKRQERLAESATGPKPVDHVEEDGHAVPLGLSLQDPPPHTGNSIFLMAPSLVP--ESAE--IE 337
                   |..       |:|..:|:        |:.|        :.|...|::.  |.|:  ::
  Fly   238 -------RFF-------PLDSQDEE--------SVGD--------LLLQIDSILQYGEDADVNVK 272

  Fly   338 DEEEMEE 344
            |.:|.||
  Fly   273 DFDEPEE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3704NP_569872.1 Gem1 24..199 CDD:224025 58/181 (32%)
ATP_bind_1 28..268 CDD:281079 69/249 (28%)
CG2656NP_649699.1 Gem1 2..196 CDD:224025 59/193 (31%)
ATP_bind_1 7..263 CDD:281079 79/313 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473011
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.