DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3704 and CG10222

DIOPT Version :9

Sequence 1:NP_569872.1 Gene:CG3704 / 31043 FlyBaseID:FBgn0040346 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001287060.1 Gene:CG10222 / 39504 FlyBaseID:FBgn0036356 Length:307 Species:Drosophila melanogaster


Alignment Length:190 Identity:48/190 - (25%)
Similarity:90/190 - (47%) Gaps:7/190 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LVLGMAGSGKTTFTQKLIQHAQEKFNPY-VVNLDPACREVPYAAHVDIRDTVNYREVMKQYQLGP 90
            |::|..||||||:..:.::..:|..... |||||||...:.|...:.:.:.:...:.|:..:|||
  Fly    19 LIIGPPGSGKTTYCGEALKFYRELGRQVGVVNLDPANENMSYEPVLSVMELITVEDCMEHLKLGP 83

  Fly    91 NGGIVTALNMFTTKMAQFAELVRRAGERGHKWCVIDTPGQIEVFNWSASGSIITEGL-ATMFPTI 154
            ||.::.........:..:.....|.....:.:.:.|.|||:|::....:.:.|.|.| ...:..:
  Fly    84 NGALMHCAEYLADHLEDWLLPALRKLSATYNYFLFDCPGQVELYTHHNAMARIFERLERERYSLV 148

  Fly   155 VVYVMDVERSACPTTFMSNMLYACSILYKTRLPFLVALNKIDL-----KDCGFVMDWMTD 209
            .|.::|....:.|..|::.:|.|.:.:.:..||.:..|:|.||     ....|.:|:.||
  Fly   149 TVNLIDSHYCSEPAKFIATLLMALNTMLRMSLPHVNVLSKADLLKKHETKLHFNVDYYTD 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3704NP_569872.1 Gem1 24..199 CDD:224025 44/178 (25%)
ATP_bind_1 28..268 CDD:281079 47/189 (25%)
CG10222NP_001287060.1 Gem1 19..193 CDD:224025 44/173 (25%)
ATP_bind_1 20..271 CDD:281079 47/189 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473010
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.