DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRAM and LAC1

DIOPT Version :9

Sequence 1:NP_001245456.1 Gene:TRAM / 31042 FlyBaseID:FBgn0040340 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_012917.3 Gene:LAC1 / 853861 SGDID:S000001491 Length:418 Species:Saccharomyces cerevisiae


Alignment Length:354 Identity:70/354 - (19%)
Similarity:146/354 - (41%) Gaps:62/354 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IISCVAMVFVVGLMNESTAAFASAFISLHHNVSGEDPSREQPYGKPYTYIAGIKDYCAIFFYTLT 95
            :|:..:..|..|  |.:.......|:::.:.:...:     .|||      ||.|.|.:|:|   
Yeast    91 LIAVYSAYFTSG--NTTKTNVLHRFVAVSYQIGDTN-----AYGK------GINDLCFVFYY--- 139

  Fly    96 CIIMHAIIQEFVLDKISK----KLHL-SKFKLARFNESGQLVAFYLLSFVWGAHVLL-KEGYLGQ 154
             :|....::||::|.:.:    :||: ||.::.|..|....:.:..:|..:|.:.:. .:.:...
Yeast   140 -MIFFTFLREFLMDVVIRPFAIRLHVTSKHRIKRIMEQMYAIFYTGVSGPFGIYCMYHSDLWFFN 203

  Fly   155 VAQLWEGFPDHPMSFLHKFYFVVQLAYYLHMLPELYFQKIKTKEEQQPKIVHSISGFTLIVLAYT 219
            ...::..:||....||.|.:::.|.|::......|..|..|.:::......|.|....||..:|.
Yeast   204 TKAMYRTYPDFTNPFLFKVFYLGQAAFWAQQACILVLQLEKPRKDHNELTFHHIVTLLLIWSSYV 268

  Fly   220 LSFQRLAL-VLLTLHY------FSELLSH-----------VFQLIGVFDRE--------ERLAKL 258
            ..|.::.| :.:|:..      ||:.|::           :|.:..::.|.        ..|.:.
Yeast   269 FHFTKMGLPIYITMDVSDFLLSFSKTLNYLDSGLAFFSFAIFVVAWIYLRHYINLKILWSVLTQF 333

  Fly   259 RVVNNAVFFLIRFATSVIGV---LTLYYGIGGVRSLLALGGLIALQGYLVFSFITEQLRAKREAK 320
            |...|   :::.|||.....   |.:.:.:.|...|:.|..|     :|:|..:...|  .|...
Yeast   334 RTEGN---YVLNFATQQYKCWISLPIVFVLIGALQLVNLYWL-----FLIFRVLYRIL--WRGIL 388

  Fly   321 KEAKREAKLALQTKKPAKTPKDKVKRKKE 349
            |:.:.:::...::.:.:.||.|....||:
Yeast   389 KDDRSDSESDEESDESSTTPTDSTPTKKD 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRAMNP_001245456.1 TRAM1 52..121 CDD:285576 18/73 (25%)
TLC 124..290 CDD:214789 35/195 (18%)
LAC1NP_012917.3 LAG1 9..389 CDD:227391 64/324 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1077
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.