DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRAM and hyl-2

DIOPT Version :9

Sequence 1:NP_001245456.1 Gene:TRAM / 31042 FlyBaseID:FBgn0040340 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_508803.3 Gene:hyl-2 / 180743 WormBaseID:WBGene00002044 Length:329 Species:Caenorhabditis elegans


Alignment Length:345 Identity:71/345 - (20%)
Similarity:130/345 - (37%) Gaps:90/345 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 FASAFISLHHNVSGED---PSREQPYGKPYTYIAGIKDYCAIFFYTLTCIIMHAIIQEFVLDK-- 110
            :..|...|...||..|   .:.|..|..|:        |..::...||.|.:  ||..||.:.  
 Worm     4 WTDALYWLPRGVSWSDMYNKTTEPGYMYPH--------YSHLWMTVLTGISL--IIYRFVFENYI 58

  Fly   111 -------ISKK---------LHLSKFKLARFNESGQLVAFYLLSFVWGAHVLLKEGYLGQVAQLW 159
                   :|:|         |...| |.:|..|......:|.:|||.|.:::|.|.:|..:.:.|
 Worm    59 FVPLAHFLSRKNPPETRRGTLDREK-KYSRMAECAMRALYYTISFVCGLYLVLHESHLYDITECW 122

  Fly   160 EGFPDHPMSFLHKFYFVVQLAYYLHMLPELYFQKIKTKEEQQPKIVHSISGFTLIVLAYTLSFQR 224
            ..:|.||:.....:|:.:|..:|:.::..:.|...|..:..| .:||......||.:::|::..|
 Worm   123 RNWPFHPIPNAVAWYYWIQGGFYIALVFGILFLDAKRSDFWQ-MLVHHFITLALIGVSWTMNMVR 186

  Fly   225 LALVLLTLHYFSELLSHVFQLIGVFDREERLAKLRVVNNAVFFLIRFATSVIGVLTLYYGIGGVR 289
            :..::|..|...::|..|.:::    |.|:......:..|....:..||.::     ||....:|
 Worm   187 VGTLILVSHDAVDILIDVGKIL----RYEQFETALTICFAGVLFVWVATRLV-----YYPFWIIR 242

  Fly   290 S----------------------------LLALGGLIALQ---GYLVF----------------- 306
            |                            :|.|..|:.|.   .|::|                 
 Worm   243 SVWFDAPALIQDDYEWLNFDQQPQAPRFIMLLLTALLILHIFWAYILFKIAYDTIQEGVVDDVRE 307

  Fly   307 SFITEQLRAKREAKKEAKRE 326
            .|..:.|..:.:||::.|.:
 Worm   308 DFDEQSLVNREKAKQQNKNK 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRAMNP_001245456.1 TRAM1 52..121 CDD:285576 20/89 (22%)
TLC 124..290 CDD:214789 37/165 (22%)
hyl-2NP_508803.3 TLC 86..298 CDD:214789 45/221 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.