DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRAM and tram2

DIOPT Version :9

Sequence 1:NP_001245456.1 Gene:TRAM / 31042 FlyBaseID:FBgn0040340 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001135493.1 Gene:tram2 / 100216032 XenbaseID:XB-GENE-960498 Length:372 Species:Xenopus tropicalis


Alignment Length:377 Identity:146/377 - (38%)
Similarity:207/377 - (54%) Gaps:35/377 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KNPPILSHEFVIQNHADIISCVAMVFVVGLMNESTAAFASAFISLHHNVSGEDPSREQPYGKPYT 78
            |:.|:.|.||||.|||||.....:..::|||.|.||..|..||...:|.|.:....|..|   |.
 Frog     7 KSYPLFSQEFVIHNHADIGFFFVLCVLIGLMFEVTAKTAFIFILPQYNSSIQSLDGELVY---YH 68

  Fly    79 YIAGIKDYCAIFFYTLTCIIMHAIIQEFVLDKISKKLHLSKFKLARFNESGQLVAFYLLSFVWGA 143
            |  |:||...|.||.:..||:|||:||::||||:::|||||.|.:||||||||.||:|.|..|..
 Frog    69 Y--GVKDLVTILFYVVIAIILHAIVQEYILDKINRRLHLSKVKQSRFNESGQLAAFHLASMFWCL 131

  Fly   144 HVLLKEGYLGQVAQLWEGFPDHPMSFLHKFYFVVQLAYYLHMLPELYFQKIKTKEEQQPKIVHSI 208
            :|...||||.....|||.:|...:.|..||:::.||||:||.||||||||:| |||...::.:.:
 Frog   132 YVSATEGYLSNPKTLWENYPHVYLPFQVKFFYLCQLAYWLHALPELYFQKVK-KEEVPRQLQYIV 195

  Fly   209 SGFTLIVLAYTLSFQRLALVLLTLHYFSELLSHVFQLIGVFDREERLAKLRVVNNAVFFLIRFAT 273
            .....|..||.|:..||.|:||.|...:|.|.|:.:|....|  |...||......:|.:.|..|
 Frog   196 LYLLHIAGAYLLNLTRLGLILLLLQSVAEFLFHIARLFYFID--ENNQKLFNAWGVIFVVTRLFT 258

  Fly   274 SVIGVLTLYYGI------------GGVRSLLALGGLIAL----QGYLVFSFITEQLRAKREAKKE 322
            ..:.|||:.:|:            |...:||....::.|    |.::::.||..|||..||..||
 Frog   259 LTLTVLTVGFGLARAEIHTFNPDKGDFNTLLFRMVVLLLMCISQTWMMWRFIHFQLRRWRECCKE 323

  Fly   323 ---AKREAKLALQTKKPAKTPKDKVKRKK---ESDLPEADQTSPSPIKQKLK 368
               .||.|..|:..::.||.    :||:.   |:.:.:|:..| :|.::|:|
 Frog   324 QAARKRSAVAAMVKQQQAKV----LKRESGYHENGVVKAENGS-TPRQKKIK 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRAMNP_001245456.1 TRAM1 52..121 CDD:285576 31/68 (46%)
TLC 124..290 CDD:214789 69/177 (39%)
tram2NP_001135493.1 TRAM1 48..109 CDD:369849 30/65 (46%)
TLC 111..319 CDD:214789 78/210 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 122 1.000 Domainoid score I5581
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 252 1.000 Inparanoid score I3133
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D496777at33208
OrthoFinder 1 1.000 - - FOG0002124
OrthoInspector 1 1.000 - - otm49197
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1077
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.